Details for Chinese cabbage Locus Brara.E02819

Position : A05 ( 5`- 24274161 .. 24275418 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02819

Protein [Map View]
MASSLPQFYADFTFSGNTSSQFHGSSSCPDVSALSNYYDDGYLPFNASSIPESTFYPQVFGTSDAPMQEYNYYYQKMGVN
NATQYFHGGDQEYYGFSPEIKPFGEQSWGSSEGGIQAEQNTKVGRYSVEERKERIMRYLKKKNQRNFNKTIKYVCRKTLA
DRRVRVRGRFARNNDTCEQQSHMSKTHNNNSEKEEDIFSGSDDYLIQMENDDGWLNEAMSNLISFPCELDAPGDDHNPST
WSF*

DNA
ATGGCATCATCTCTTCCTCAGTTCTACGCCGATTTCACATTTTCCGGCAACACTTCTTCACAGTTTCACGGCTCTTCTTC
ATGTCCTGACGTCTCAGCTCTATCCAATTACTATGACGACGGTTACCTCCCCTTCAACGCATCTTCTATCCCAGAATCCA
CATTTTATCCCCAAGTTTTTGGAACTTCTGACGCTCCTATGCAGGAGTACAACTATTATTACCAGAAAATGGGTGTGAAC
AATGCCACACAATATTTTCATGGTGGTGATCAAGAATACTACGGCTTTTCACCAGAAATCAAGCCCTTTGGAGAGCAATC
TTGGGGATCTAGTGAAGGAGGCATACAAGCTGAGCAGAACACAAAAGTGGGACGCTATTCGGTTGAAGAACGTAAAGAGA
GAATCATGAGGTACTTGAAAAAGAAGAACCAACGCAACTTCAATAAGACCATCAAGTATGTATGCCGTAAAACCCTAGCT
GACCGGCGTGTTCGTGTTCGAGGACGATTTGCTAGAAACAATGACACATGTGAACAACAATCTCACATGTCTAAAACTCA
CAACAACAATTCTGAAAAAGAAGAAGATATATTTTCTGGATCCGACGACTATCTAATCCAGATGGAAAACGATGATGGAT
GGCTTAACGAAGCAATGTCTAATCTGATTTCTTTTCCTTGTGAATTGGACGCTCCTGGAGATGATCATAATCCAAGCACA
TGGAGCTTCTGA