Details for Chinese cabbage Locus Brara.E02816

Position : A05 ( 5`- 24239512 .. 24240928 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02816

Protein [Map View]
MAVEAHHLNHLYSSNNRERMNPVEANGLVYNTQMRYNTVQATTMPFNPAMECQTSLLNPVYNLSPFDCLAQQSMKPMIHS
VESSLTFNSETNGNVGYLCPVSSSSMRKRPREESAVVNHMPSQKRCTDPLMFLGQDLSSNVQHHNFDIDRLISHHVEIMR
MEIEEKRKAQGRKIMEAIEQGLAKTLRAKDEEINHIGKLNLFLEEKVRSLCVENQIWRDMAQSNEATVNSLRSNLQQVLA
AVERNKWEEPTAADDAQSCCGSNDEGDSDERWRLAGEAKSVRTITSTMCRGCGKGEASVLLLPCRHMCLCTVCGSSVNTC
PVCKSPKNASLHVNLSS*

DNA
ATGGCCGTTGAAGCTCACCATTTAAATCATCTATATTCTTCTAATAACAGAGAAAGGATGAATCCCGTTGAAGCCAACGG
TTTAGTCTATAACACCCAAATGAGATATAACACTGTTCAAGCGACGACCATGCCGTTTAACCCCGCCATGGAATGTCAAA
CTTCTCTGTTGAATCCAGTTTACAACCTCTCACCGTTTGATTGCCTGGCTCAACAGTCCATGAAACCGATGATCCATTCT
GTTGAGAGTTCCTTGACATTCAACAGCGAGACTAATGGCAACGTCGGTTATCTTTGTCCTGTTTCTTCGTCGTCTATGCG
AAAACGCCCTAGAGAAGAATCAGCAGTTGTTAATCATATGCCAAGCCAGAAACGTTGCACTGATCCTCTCATGTTCCTCG
GACAAGACTTGTCTTCCAACGTCCAACATCACAACTTCGATATCGACCGTTTGATCTCTCATCATGTTGAGATAATGAGA
ATGGAGATTGAAGAAAAGAGAAAAGCGCAAGGTAGGAAGATAATGGAAGCCATTGAACAAGGGTTGGCGAAGACACTGAG
AGCCAAAGACGAAGAGATCAATCACATAGGGAAACTAAACCTCTTTCTTGAGGAGAAGGTTAGGTCTCTCTGCGTAGAGA
ATCAGATATGGCGTGACATGGCACAGTCTAATGAAGCCACCGTGAACTCCCTACGTTCAAACTTGCAACAAGTCCTCGCA
GCTGTGGAACGTAACAAGTGGGAGGAGCCCACGGCGGCTGATGACGCGCAGTCTTGTTGTGGAAGCAACGACGAGGGTGA
TAGTGACGAGCGGTGGAGGTTAGCAGGAGAGGCTAAAAGCGTGCGTACGATAACAAGCACGATGTGTAGAGGGTGTGGGA
AAGGAGAAGCAAGTGTGTTACTGTTGCCGTGTAGACACATGTGTTTATGCACTGTGTGTGGATCTTCGGTTAACACTTGT
CCAGTCTGTAAATCTCCAAAGAATGCTAGTCTCCATGTTAATCTTTCCTCGTGA