Details for Chinese cabbage Locus Brara.E02807

Position : A05 ( 5`- 24189780 .. 24193345 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02807

Protein [Map View]
MVITAKLQSLRMYDSQVLKSKSEGKERCQESTSGESFLYRYQLEEDVKRLQLQLQEELKLHTFLESIMEKDPWELTSACS
VPHHAQELLSNISTLETAVTKLEQEMMSLNFQLSQERNERRLTEYHLTHSASPPNISSSLIYLNHSDSEVHQSAEDNPCQ
NQDSSSESSQAESTVKKSNQILEKRLMRKTNGRKLPKYMWDHPNLLSEEMVRCMKNIFMSLADQTKASSNESQLLSPVAS
PRGHLSSSSSWWPSTERSKISSWVQSPQIDIQRSNNDVLATGNVFDPYRVRGKLSWSEIGNYSLASEVSWMSVGKKQLEY
ASGALRRFRTLVEQLARVNPIHLSCDEKLAFWINVYNALIMHAYLAYGVPKSDLKLFSLMQKAAYTVGGHSYTAAAMEYV
ILKMKPPTHRPQIALLLAINKVKVSEEQRKASIDTHEPLLSFALSCGMYSSPAVRIYTAKGVKEELLEAQREFIQASVGL
SSKGKLLVPKMLHCYAKSLVEDSNLGVWISKYLPPHQAAFVEQCISQRRRQSLLSSRNCGILPFDSRFRYLFLPDNNNNN
SCV*

DNA
ATGGTGATAACTGCCAAACTCCAGAGCCTTAGGATGTATGACTCTCAAGTTTTGAAATCTAAGTCAGAGGGCAAAGAGAG
ATGCCAAGAGTCTACAAGTGGTGAATCGTTTCTGTATAGATACCAACTTGAAGAGGATGTAAAAAGATTGCAACTGCAAC
TACAAGAAGAATTAAAGCTGCATACTTTTTTAGAGAGCATCATGGAGAAGGATCCTTGGGAGCTAACTTCTGCTTGTAGT
GTTCCACATCATGCTCAAGAACTGCTTTCCAATATATCCACCCTAGAGACTGCAGTCACCAAGCTAGAGCAAGAAATGAT
GTCTCTGAACTTCCAACTTAGCCAAGAAAGAAACGAGAGAAGACTAACTGAATATCATTTGACACACTCAGCTTCTCCAC
CAAACATTTCTTCTTCCTTGATATATTTGAATCATTCGGATTCTGAAGTACATCAATCAGCAGAAGACAATCCATGCCAA
AACCAAGACTCTTCATCTGAATCATCTCAGGCAGAATCAACTGTTAAGAAGAGTAATCAAATTCTTGAGAAGAGACTAAT
GAGAAAGACAAATGGGAGGAAGCTACCTAAGTACATGTGGGATCACCCTAATCTACTCTCTGAAGAAATGGTGAGATGTA
TGAAGAACATCTTCATGTCACTTGCTGACCAGACAAAAGCATCCTCAAACGAGAGCCAACTACTCTCACCGGTGGCATCA
CCACGTGGGCATCTATCAAGCTCATCATCCTGGTGGCCTTCAACAGAACGGTCAAAAATCTCTTCATGGGTGCAAAGCCC
TCAGATAGATATCCAAAGAAGTAACAACGATGTCTTGGCCACAGGAAACGTCTTTGATCCTTACAGAGTTCGTGGGAAGC
TAAGCTGGTCGGAGATTGGAAACTACAGTTTGGCATCCGAGGTTTCTTGGATGTCTGTTGGGAAGAAACAGCTTGAATAT
GCTTCTGGTGCATTGAGAAGGTTCAGGACACTGGTGGAGCAGCTTGCTAGAGTAAACCCAATTCATTTGAGCTGTGATGA
GAAGCTAGCTTTCTGGATTAACGTTTATAACGCGTTGATCATGCATGCGTATTTGGCTTATGGTGTCCCAAAAAGTGACT
TGAAGCTCTTCTCGTTGATGCAAAAGGCTGCCTATACGGTTGGAGGACACTCGTATACTGCAGCTGCAATGGAGTATGTG
ATACTGAAGATGAAACCGCCTACGCACAGGCCACAAATTGCTTTGCTTCTTGCCATCAACAAGGTGAAAGTATCAGAAGA
ACAACGCAAGGCAAGCATTGATACACATGAGCCTCTTCTCTCCTTTGCCTTAAGCTGCGGAATGTACTCTTCTCCTGCGG
TGAGGATCTACACAGCGAAAGGAGTGAAGGAAGAGCTACTAGAAGCTCAAAGAGAGTTCATACAAGCATCGGTAGGGCTG
AGCAGCAAAGGGAAGCTCCTGGTACCCAAAATGCTTCATTGTTACGCCAAGAGTTTGGTGGAGGATTCGAACTTGGGGGT
CTGGATATCGAAGTACCTTCCACCGCATCAAGCAGCTTTTGTGGAACAGTGCATCTCTCAGAGAAGAAGACAAAGTCTTC
TCTCCTCACGTAACTGTGGAATACTCCCCTTTGATTCTCGTTTCAGATATCTGTTTCTCCCTGACAACAACAACAACAAC
TCGTGTGTGTAA