Details for Chinese cabbage Locus Brara.E02803

Position : A05 ( 5`- 24172334 .. 24176644 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02803

Protein [Map View]
MTGMALELSVLGRSVVSTKASNLKRYGQKPNLSGRLLTRAAELHCPVMSSKNSTLSFRFRRSCELSSSYRSRFMLFSSSQ
CSQQSSDSGGKELEWIKVLLKRGIVIGAVVCGVYLYGCKKVLASSSGVVEAGHEVFGQGLVLFKNALPKIYQVLKVLREQ
GLILAALFGLSAFFSMAETSITTLWPWKVRELAEKEPENGVFRMLRSDVTRFLTTILIGTTVVNIAATALVTEAATAIFG
EAGVSAATGLMTVAILLLTEITPKSVAVHNAQEVARIVVRPVAWLSLVLYPVGRIVTYLSMGILKILGLKGRSEPYVTED
ELKLMLRGAELSGAIEEEEQDMIENVLEIKDTHVREVMTPLVDVVAIDASGSLVDFHSMWVTHQYSRVPVFEQRIDNIVG
IAYAMDLLDYVQKGDLLESTSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEI
FDENDSKEEIQKKTGYIVMRDEGVYDVDANTSIDQLSEELNIKMPEGIQYETVSGFVCEAFGYIPKTGESVKVVLEKENW
EEEGEEEEGNKQERQEQKEKHQIYRVEILAGNARKVSAVRFERVNDMDQVSEAKDVRSMVPKFVRKWSSEEDDGNSSYQE
KTEDAVSDDEHVLADNSNKQH*

DNA
ATGACGGGTATGGCACTTGAGTTATCGGTTCTGGGTCGGTCTGTTGTTAGCACAAAAGCCTCAAACTTGAAGAGATACGG
TCAAAAACCAAACCTTTCTGGTAGACTTCTCACGAGAGCTGCTGAGCTGCACTGCCCTGTGATGTCGTCTAAAAACTCCA
CTTTGAGTTTTAGATTCCGGCGAAGCTGTGAACTTAGCAGCAGCTACAGAAGTCGCTTTATGCTGTTTAGCTCGAGTCAA
TGTAGTCAACAAAGTTCGGATTCTGGAGGGAAAGAGCTGGAGTGGATTAAGGTTTTGCTGAAACGTGGGATTGTTATAGG
AGCTGTGGTGTGTGGAGTTTACTTGTATGGATGTAAAAAGGTGTTGGCATCGTCGAGCGGTGTGGTGGAAGCAGGGCATG
AGGTGTTTGGTCAGGGCCTAGTCTTGTTCAAGAATGCTTTGCCGAAAATTTACCAGGTTCTTAAGGTTCTTAGAGAGCAA
GGTCTGATATTGGCTGCACTGTTCGGCCTCTCAGCGTTTTTCTCTATGGCAGAGACGTCCATTACCACTCTGTGGCCCTG
GAAGGTGCGTGAGCTGGCTGAGAAAGAGCCAGAGAATGGTGTATTCAGAATGCTCCGTAGTGATGTTACCAGATTCTTGA
CGACTATTCTCATTGGAACAACTGTTGTGAATATTGCGGCAACTGCCCTGGTCACTGAAGCAGCAACAGCTATATTTGGT
GAAGCTGGTGTTAGTGCAGCCACTGGACTGATGACAGTGGCTATATTGCTTCTAACTGAGATTACTCCAAAAAGTGTTGC
TGTTCACAATGCTCAAGAAGTTGCAAGGATTGTGGTTAGGCCAGTGGCGTGGCTTTCCTTAGTATTATATCCTGTCGGAA
GAATTGTCACGTATCTGTCAATGGGAATACTGAAAATTCTTGGCTTAAAAGGACGGAGTGAGCCATATGTTACTGAAGAT
GAGTTGAAACTGATGCTACGGGGTGCAGAGTTAAGTGGCGCCATTGAAGAAGAGGAGCAGGATATGATTGAAAATGTGCT
GGAGATAAAAGACACACATGTTCGAGAGGTGATGACACCTCTTGTTGATGTAGTTGCAATTGACGCCAGCGGCAGTCTAG
TTGATTTCCATAGCATGTGGGTGACCCATCAGTACTCGAGGGTGCCTGTTTTTGAGCAGCGTATAGATAATATAGTGGGA
ATCGCATATGCTATGGATCTTCTAGATTATGTTCAGAAGGGTGATCTGCTAGAGAGTACTTCTGTGGGAGACATGGCACA
CAAACCTGCCTACTTTGTCCCCGATTCAATGTCAGTTTGGAATCTTCTTAGAGAATTTCGCATAAGAAAGGTTCACATGG
CTGTTGTCCTGAACGAATATGGTGGAACCATTGGTATAGTAACTCTTGAAGATGTGGTGGAAGAGATTGTTGGTGAAATA
TTTGATGAAAATGACTCAAAAGAGGAGATTCAGAAGAAGACAGGGTACATTGTGATGAGAGACGAGGGAGTATATGATGT
TGATGCTAATACATCAATTGATCAGCTATCTGAAGAACTGAATATAAAGATGCCAGAGGGGATTCAGTATGAGACAGTCT
CAGGCTTTGTGTGTGAGGCCTTTGGGTATATCCCAAAAACGGGAGAAAGTGTAAAAGTTGTTCTTGAAAAGGAAAACTGG
GAAGAGGAGGGTGAAGAAGAGGAAGGTAACAAACAGGAGAGGCAGGAGCAGAAGGAAAAGCATCAAATCTATAGAGTTGA
GATTCTAGCAGGGAATGCAAGAAAAGTGAGTGCTGTCAGGTTTGAAAGAGTCAATGACATGGATCAAGTGTCGGAGGCAA
AAGATGTAAGAAGCATGGTTCCTAAATTCGTGAGGAAGTGGAGCAGTGAAGAGGATGATGGGAACTCGTCGTACCAAGAA
AAAACCGAGGATGCCGTCTCAGATGATGAACATGTATTGGCTGATAATAGCAACAAACAACATTGA