Details for Chinese cabbage Locus Brara.E02797

Position : A05 ( 5`- 24147933 .. 24148611 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02797

Protein [Map View]
MSCDIKVNNSCELCHRKVDEVMQSLTAFYSVTYLGENNTIKLKARANPNVIMWISHKYGDHGKISNFHMNGQPVTPQPGG
GGYYGPSGYNLPSNTSGYYPYPPPPQFLAGNYGYPMPNPPPPQKESTPQGIYKQHTAPPSYVMQPPPPMPLSSYSYIEPP
YWPMSGR*

DNA
ATGAGCTGTGATATAAAAGTGAACAATAGCTGCGAGCTTTGCCATCGAAAAGTGGATGAAGTTATGCAGTCTCTCACCGC
ATTTTACTCTGTGACTTATCTTGGAGAAAACAACACAATTAAGCTCAAGGCGAGAGCTAACCCTAATGTGATTATGTGGA
TCAGTCACAAGTACGGCGATCACGGCAAGATCTCCAACTTCCATATGAACGGCCAACCTGTCACCCCTCAACCTGGCGGC
GGCGGTTATTACGGTCCTTCAGGCTATAACCTTCCTTCCAACACCTCCGGTTATTATCCATACCCTCCGCCGCCGCAGTT
TCTAGCCGGGAACTATGGCTACCCTATGCCTAATCCACCTCCACCGCAGAAGGAGAGTACTCCACAGGGGATATATAAGC
AGCATACAGCGCCACCGTCTTATGTGATGCAGCCACCACCGCCAATGCCGTTGTCTAGTTACTCTTATATTGAACCTCCG
TATTGGCCGATGAGTGGGAGGTAA