Details for Chinese cabbage Locus Brara.E02794

Position : A05 ( 5`- 24127982 .. 24129426 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02794

Protein [Map View]
MATFHSVQHAVKLFNAGLSGGEHLNQRQEQEVLVEETDVNKLKEKIKNAEMAKIEALLELDEAKKTVEHLNHKLEIRNNN
MRSDEKGLALRSSSSSSNVRDVSSELGIAKELLQRVAAEEESRQDLDVSSSHNVIVVTSELGFAKESLHRAAEEESELCL
LMESLKLELENVKKEHSELKEKEQRETEQAVEELKKEAEDAKRELLQLEEELKIALKEAEEAKAKAAEECLNVQESCYGG
GLTETEALRACRDETLKKLEMSEKEIEDIKAATQEALKNAEMAEEATIVVDLELKRRRKAASRMWAKSFPSAKEVDKSKS
RSKETCLVKC*

DNA
ATGGCTACTTTTCATTCTGTTCAACATGCAGTGAAGCTCTTCAACGCTGGTTTATCTGGTGGAGAACATCTCAACCAGAG
GCAAGAACAGGAAGTGTTGGTGGAAGAGACAGATGTTAACAAGTTGAAGGAGAAAATAAAGAATGCAGAGATGGCGAAGA
TTGAGGCTTTGTTAGAGCTTGATGAAGCTAAAAAAACGGTTGAGCATCTCAATCACAAGCTGGAGATTAGGAATAATAAC
ATGAGGAGTGATGAGAAAGGTTTAGCTTTGAGAAGTAGTAGTAGTAGTAGTAATGTGAGAGATGTGAGTTCAGAGCTAGG
GATTGCTAAAGAATTGCTTCAAAGAGTAGCAGCTGAAGAGGAGAGTCGCCAGGACTTAGATGTGAGTAGTAGTCATAATG
TGATAGTTGTGACTTCTGAGCTAGGCTTTGCTAAGGAATCACTTCATAGAGCAGCTGAAGAGGAGAGTGAACTGTGTTTG
TTAATGGAGTCTCTTAAACTCGAGCTTGAGAACGTTAAGAAAGAACATTCAGAGCTTAAGGAGAAAGAGCAGAGAGAAAC
AGAACAAGCCGTTGAGGAGCTGAAGAAGGAAGCTGAAGATGCAAAGAGGGAGCTTTTGCAGTTAGAGGAAGAGCTAAAGA
TCGCTCTTAAAGAGGCAGAAGAAGCAAAAGCAAAAGCTGCAGAGGAATGTCTAAACGTTCAAGAAAGTTGTTATGGTGGT
GGATTAACTGAGACGGAAGCATTGAGAGCATGCAGAGATGAAACGCTGAAGAAACTGGAGATGAGCGAGAAGGAGATTGA
AGATATCAAAGCTGCAACGCAAGAGGCGTTGAAGAATGCAGAGATGGCTGAAGAAGCTACAATTGTGGTGGACTTAGAGC
TTAAAAGACGGCGTAAAGCAGCTAGTAGGATGTGGGCTAAGTCGTTTCCCTCCGCAAAGGAAGTGGACAAGTCGAAATCA
AGATCCAAAGAGACTTGCTTAGTCAAGTGCTAG