Details for Chinese cabbage Locus Brara.E02789

Position : A05 ( 5`- 24115098 .. 24116479 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02789

Protein [Map View]
MVDMEVNGTYASKGKIWHPDDNLFLAYYLVSILISSSVRLEICYLALLSSFESFQAFVDSGAQSTIISKSCAERCGLLRL
MDQRYEGILLMVLVNQR*

DNA
ATGGTGGATATGGAGGTTAACGGTACGTACGCCTCTAAAGGCAAAATTTGGCATCCAGATGATAACCTCTTTTTGGCTTA
CTATCTGGTTTCGATCTTAATCAGTTCCTCAGTGCGCTTAGAGATTTGTTATTTAGCACTCCTTAGTTCGTTTGAATCAT
TCCAGGCTTTTGTTGATAGTGGTGCACAATCAACAATTATATCCAAGAGTTGTGCTGAGAGATGCGGGTTGCTGAGACTC
ATGGATCAACGCTATGAAGGTATATTGCTCATGGTGTTGGTTAATCAGAGATAG