Details for Chinese cabbage Locus Brara.E02788

Position : A05 ( 5`- 24114269 .. 24114854 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02788

Protein [Map View]
MCCGRICMLCTCLILVVIAIGFLFGFGVFKDGFHKIQQSVHLECDPRSGCGGGVGRRGYGFTAGNN*

DNA
ATGTGTTGTGGAAGGATATGCATGCTGTGCACGTGTTTGATTCTGGTGGTGATCGCGATCGGGTTCCTATTCGGATTCGG
AGTTTTCAAGGACGGTTTCCACAAGATCCAACAGTCCGTTCATCTCGAATGCGATCCGAGATCCGGATGCGGCGGAGGAG
TTGGACGTCGTGGTTACGGTTTCACAGCTGGTAATAACTAG