Details for Chinese cabbage Locus Brara.E02785

Position : A05 ( 5`- 24098344 .. 24098823 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02785

Protein [Map View]
MSGILVYSAASSLRFSPGTSFTAKTVGSRNGNARFPSGATSVRAYTQQTFNAEPAVTESVRRRASSLYELLKVNETASLT
EIKTAYRSLAKVYHPDASESDGRDFMEIHKAYATLADPTTRAIYDSTLVTRRRRVHAGAMGRAGRVYTTTRRWETDQCW*

DNA
ATGTCTGGAATTCTAGTTTATTCCGCCGCTAGCTCCCTTCGATTCTCGCCGGGAACTAGCTTTACGGCGAAGACAGTAGG
ATCCCGCAACGGAAACGCACGGTTTCCCTCCGGAGCTACGTCGGTCAGGGCTTATACGCAGCAGACATTCAACGCCGAGC
CAGCTGTAACGGAATCCGTTCGCCGGCGAGCGTCGAGCCTCTACGAGCTGCTGAAAGTCAACGAAACGGCGTCGCTGACG
GAGATTAAGACGGCGTACCGGAGCTTGGCGAAGGTTTACCATCCCGATGCGTCGGAATCTGACGGGCGAGATTTCATGGA
GATCCACAAAGCGTACGCGACGCTGGCGGATCCGACGACGAGAGCTATATACGATTCGACGCTGGTAACACGGCGGAGAC
GGGTTCACGCTGGAGCTATGGGTCGAGCGGGTCGGGTGTACACGACTACCCGGAGGTGGGAGACGGATCAGTGTTGGTGA