Details for Chinese cabbage Locus Brara.E02782

Position : A05 ( 5`- 24078078 .. 24080171 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02782

Protein [Map View]
MSNHQRGDDDAGEYMEEDVDDHEMQDVENNDMDDEFRGGDGASDSDVEEFDYSNNKIADTSAEQARKGKDIQGIPWDRLS
ISRDKYRQTRLLQYKNYENVPNSGESSEKVCNVTQKGGQFYGFWRNSRSVKSTILHFQLRNLVWATSKHDVYLMSNFLLT
HYSSLTSGKKEVLNVRGHVAPSEKHPGSLLEGFTQTQVSTLAVKDGFLVAGGFQGELICKHLDRPGVSFCSRTTYDDNAI
TNAIEIYNKPSGALHFTASNNDCGVRDFDMERYQLVKHFSFPWPVNHASLSPNGKLLAVVGDNPEGLIVDPNTGK

DNA
ATGTCCAATCACCAAAGAGGAGATGATGATGCTGGGGAGTACATGGAAGAAGATGTAGATGATCATGAGATGCAAGATGT
GGAAAATAATGATATGGATGACGAGTTCCGTGGCGGTGATGGTGCATCAGATTCTGACGTCGAAGAGTTTGACTACTCCA
ATAATAAAATAGCTGACACATCGGCAGAACAAGCTCGGAAAGGGAAAGATATTCAGGGGATTCCTTGGGACAGGCTTAGC
ATCTCTAGAGATAAATACAGACAAACTAGGTTACTACAGTACAAGAACTATGAAAACGTCCCTAACTCCGGAGAATCATC
TGAAAAGGTTTGCAATGTCACACAGAAAGGGGGGCAGTTCTATGGCTTCTGGCGTAATTCAAGATCTGTCAAATCTACTA
TCCTTCACTTCCAGTTGAGGAACTTGGTGTGGGCAACATCCAAGCACGACGTCTATCTTATGTCAAACTTCCTGCTGACG
CATTATTCTTCTCTAACGTCTGGTAAGAAGGAAGTTCTCAATGTTCGCGGTCATGTTGCACCATCCGAGAAACATCCTGG
AAGTTTGCTGGAAGGGTTTACGCAGACTCAAGTGAGTACACTTGCTGTAAAAGACGGCTTTCTTGTCGCTGGTGGATTTC
AAGGAGAACTTATATGCAAGCATCTTGATAGACCTGGCGTCAGCTTTTGCTCTCGTACTACTTATGATGATAATGCTATT
ACCAATGCTATTGAGATCTACAACAAACCCAGTGGTGCCCTTCATTTTACTGCCTCGAATAATGACTGTGGAGTTAGAGA
TTTTGACATGGAGAGATACCAGCTTGTTAAGCATTTTTCCTTTCCTTGGCCAGTGAACCACGCATCATTGAGTCCTAATG
GTAAATTACTAGCTGTTGTTGGCGACAATCCCGAGGGCCTTATAGTAGACCCCAACACAGGAAAG