Details for Chinese cabbage Locus Brara.E02774

Position : A05 ( 5`- 23996263 .. 23997954 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02774

Protein [Map View]
MEDANAIRYRCHMCSRSVNPVIEDEIINCNFCQSGFVEEMDETPDQATNDHPHQASESLWAPILLGMMNDHDQHQRASVE
NEDDNNDDDDDDDDGQINDGEFDLERHLEEIMRRRRRHSAAILDLLQGIRAGLSVESENNNDNNNNQDNELVVLINSFNQ
RIRIQDSVDAASAVPSGSLGDYFIGPGFEMLLQRLAENDPNNRYGTPPATKEAVESLETVMVEEGLVQCTVCLDDFEIGV
EAKEMPCKHMFHSECLLPWLELHSSCPVCRYLLPTGDDDGEAKTDADTSSNVSMENNGTSVDSSSNNPSVND*

DNA
ATGGAGGATGCAAACGCGATTAGGTATCGGTGTCACATGTGCTCTCGATCCGTGAATCCAGTCATCGAAGACGAGATAAT
CAACTGCAACTTCTGCCAAAGCGGATTCGTCGAAGAAATGGACGAAACTCCAGATCAGGCCACCAATGATCATCCTCATC
AAGCTTCTGAGTCTCTCTGGGCTCCCATCTTGCTCGGGATGATGAACGATCATGATCAGCATCAGAGAGCCTCTGTCGAA
AACGAAGATGACAACAATGATGACGACGATGACGATGATGATGGTCAGATTAACGATGGAGAGTTCGATTTGGAACGGCA
CCTGGAAGAGATCATGAGGAGAAGGAGGAGACACTCTGCCGCGATCCTCGACCTTCTCCAAGGGATCCGAGCCGGGTTAT
CGGTTGAATCCGAAAACAACAATGATAATAATAACAATCAAGATAACGAGCTTGTCGTCTTGATCAACTCCTTTAACCAG
AGGATAAGGATCCAAGACTCCGTCGACGCCGCGAGTGCCGTTCCTTCTGGATCTTTAGGCGACTATTTTATCGGACCTGG
GTTCGAGATGTTGCTGCAGCGTTTAGCTGAGAATGATCCCAACAACAGGTACGGGACGCCTCCTGCGACGAAGGAAGCTG
TTGAGTCGTTGGAGACGGTTATGGTGGAGGAAGGTTTGGTGCAGTGTACTGTGTGTTTGGATGATTTTGAGATTGGGGTT
GAGGCGAAAGAGATGCCGTGTAAGCATATGTTTCACAGCGAGTGTTTGTTGCCGTGGCTTGAGCTTCATAGCTCGTGTCC
TGTGTGTAGATATTTGCTTCCTACGGGGGATGATGATGGTGAAGCTAAGACTGATGCGGATACGTCGAGTAATGTTTCTA
TGGAGAACAATGGAACGTCGGTAGACTCGAGTTCGAACAATCCGTCGGTTAATGATTGA