Details for Chinese cabbage Locus Brara.E02773

Position : A05 ( 5`- 23994631 .. 23995869 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02773

Protein [Map View]
MSEKPPRIADIMRVSSHREVYEPCDDSFALVDALLADQTNLINHNPNLCMEIGCGSGYVITSLILLLKSKLPNVHYLATD
TNSIAARVTTETLEAHGVKAEIVCTDIASCLEERLAGLVDVMVVNPPYVPTPEYEVGMEGIASAWAGGENGRSVIDRMLP
VVDRLLSEKGWFYLVTLSSNYPAEICLMMRKRGFSWRILVQRSTEEENLVILKFWRDGDEVSLEKETSSEFSRSLSSFME
KQRR*

DNA
ATGTCCGAGAAGCCACCACGAATCGCTGACATCATGCGTGTAAGCTCGCATCGTGAGGTCTACGAACCATGCGATGACTC
ATTCGCTCTAGTCGACGCACTACTCGCCGACCAAACCAACCTAATAAACCACAACCCCAACCTTTGTATGGAGATCGGAT
GCGGAAGCGGATACGTCATCACGTCCCTCATCCTCCTCCTCAAATCAAAACTCCCCAACGTCCATTACCTAGCCACAGAC
ACAAACTCCATCGCCGCACGCGTGACAACCGAAACTCTAGAAGCACACGGAGTCAAAGCTGAGATTGTCTGCACGGACAT
AGCTTCTTGTCTAGAAGAGAGACTCGCTGGTTTGGTGGACGTGATGGTGGTGAACCCTCCTTACGTTCCTACGCCAGAGT
ACGAAGTTGGTATGGAAGGTATAGCCTCTGCTTGGGCTGGAGGGGAGAACGGGAGGAGTGTTATCGATAGAATGTTACCT
GTGGTTGATCGTTTGCTTTCGGAGAAAGGGTGGTTCTACTTGGTGACGTTGAGTTCTAATTACCCGGCGGAGATTTGTTT
GATGATGAGGAAGAGAGGCTTCTCGTGGAGGATCTTGGTTCAGAGGTCGACAGAAGAGGAGAATCTCGTTATACTCAAGT
TCTGGAGAGACGGAGATGAGGTGAGCTTGGAGAAGGAGACGTCGTCGGAGTTTTCGAGATCTTTATCATCGTTTATGGAG
AAACAACGGCGGTGA