Details for Chinese cabbage Locus Brara.E02766

Position : A05 ( 5`- 23946164 .. 23946349 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02766

Protein [Map View]
MESMKMKLMVVLMVAIVAFSAVGKAAAQTTESPAPSPTSDATMFVPALFASVVALASGFLF*

DNA
ATGGAGTCAATGAAGATGAAGCTTATGGTGGTGTTGATGGTGGCTATTGTGGCTTTCTCAGCCGTAGGAAAGGCGGCGGC
TCAGACGACAGAGTCTCCAGCTCCAAGTCCTACTTCTGATGCCACTATGTTCGTCCCGGCATTGTTTGCATCTGTTGTTG
CTTTGGCATCTGGGTTTCTCTTCTAA