Details for Chinese cabbage Locus Brara.E02761

Position : A05 ( 5`- 23934078 .. 23935351 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02761

Protein [Map View]
MTSSSGKRSVAKKITTPCCTKMGMKRGPWTVEEDKILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRG
GIAPDEEDLILRLHRLIGNKWSLIAGRIPGRTDNEIKNYWNTHLRKKLLSQGIDPQTHKPLDANNTHKPREEVSGGQNLL
EPNSSSHTDDTTVSRGSGAGKISVSVFGDEDFGFCYDDKFSSFLNSVINDDPFDSNIPILSHPLQTHDFIDEIVGTSSSL
GHDQRPEDL*

DNA
ATGACGTCATCTAGCGGGAAGAGATCGGTAGCTAAGAAAATAACGACCCCGTGTTGCACGAAGATGGGGATGAAGAGAGG
ACCATGGACGGTGGAAGAGGACAAGATTCTTGTGAGCTTCATCAAGAAAGAAGGTGAAGGAAGGTGGAGATCGCTTCCTA
AAAGAGCTGGCTTACTCCGATGTGGAAAAAGCTGCCGTCTACGGTGGATGAATTATCTCCGGCCGTCTGTTAAACGCGGT
GGTATCGCTCCCGACGAGGAAGATCTCATTCTCCGCCTTCATCGCCTCATTGGTAACAAGTGGTCCCTGATCGCCGGGAG
GATACCGGGAAGGACTGATAATGAGATCAAGAACTACTGGAACACTCATCTTCGTAAGAAACTCTTAAGCCAGGGCATTG
ATCCTCAAACCCACAAGCCTCTTGATGCAAACAACACCCATAAACCTAGAGAAGAAGTTTCAGGTGGACAAAATCTTCTA
GAGCCTAATTCTAGTTCTCACACTGATGATACCACCGTTAGCAGGGGAAGTGGAGCTGGCAAGATCAGTGTCAGCGTCTT
TGGTGATGAGGACTTTGGTTTCTGTTACGATGACAAGTTCTCTTCGTTTCTGAACTCGGTTATAAATGATGATCCTTTTG
ATAGCAATATTCCAATATTATCCCATCCGTTGCAGACACATGATTTTATCGATGAGATTGTTGGAACCTCGTCGAGCTTG
GGACATGACCAGAGACCAGAAGATCTATAG