Details for Chinese cabbage Locus Brara.E02760

Position : A05 ( 5`- 23922534 .. 23924024 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02760

Protein [Map View]
MMTTPGGSGRFKPLPTAMYAGYSGTASSWVAKTSVSASGKRIQREMAELNVDPPPECSAGPKGDNLYHWIATIIGPSGTP
YEGGIFFLDMIFPSDYPFKPPKVVFKTRIYHCNVDASGNLSVEILRDSWSPALTITKVLQAIRSIFLKPETYNPALPVIA
RLYLSDREKHEEVAKEWTLRFAK*

DNA
ATGATGACAACACCAGGCGGAAGCGGGAGATTTAAGCCGTTACCGACGGCGATGTACGCCGGATACTCAGGAACGGCGTC
GTCTTGGGTAGCGAAGACATCGGTTTCCGCGTCTGGGAAGAGGATACAGAGAGAGATGGCTGAACTTAACGTCGATCCGC
CTCCCGAATGCTCAGCTGGACCCAAAGGAGATAATCTCTACCATTGGATCGCCACCATCATTGGTCCCTCTGGGACTCCT
TATGAAGGAGGGATCTTTTTTCTGGATATGATTTTTCCTTCTGATTATCCCTTTAAACCACCAAAGGTGGTGTTCAAGAC
TCGGATCTACCACTGCAATGTTGATGCTTCGGGGAACTTAAGTGTGGAGATTCTAAGAGACAGTTGGAGTCCGGCTCTCA
CAATCACAAAAGTTCTACAAGCGATCAGATCTATCTTCTTAAAACCTGAGACGTACAATCCAGCTTTACCAGTGATCGCA
CGGCTCTACTTGTCGGATAGAGAAAAGCATGAGGAGGTAGCTAAGGAATGGACGTTGCGATTTGCCAAGTGA