Details for Chinese cabbage Locus Brara.E02755

Position : A05 ( 5`- 23900859 .. 23902166 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02755

Protein [Map View]
MENLTIDRPATHEHTLTFIRQKNSFNCVACRMVVANKEMNFYGMYEINMYGCLPCNFFIHRDCMFLPKVIKLTRHSHRLF
HTFQVPDYNTNCRICGDPFVCGSGGYICTDETCDYKLHSYCATHKKIWDGKDVEREPEEISNSEDVTFSSLEEVDGKTIR
HFSHHHDLVRQYVNGGEEENKRVCQACILGIGSGPFLGCKECDFALHDTCARLPRKMEHPFHRHPITLEVDMMNIKEGFF
RCSKCERESCGFMYRCCQEECEFKMDTRCASLADPLYNGAHQHPLTLLGRGARCYKCGFYLDSEQATLPVLVKCNYDIHP
LTLFLGISINMWPWKPFACEVCELRIKPTYPDYQDLYGCFDCDTVVHVECAIGKYPYLKPGHTIKLNGFEIEIASNSTLS
RPICHACHSICQDKLVFNNKSSAISFCSINCITSS*

DNA
ATGGAGAATCTGACAATAGATCGTCCAGCGACACATGAACATACGCTCACCTTCATTCGCCAAAAGAACTCTTTCAACTG
TGTTGCTTGCAGAATGGTCGTCGCTAACAAAGAGATGAATTTCTACGGTATGTACGAGATAAATATGTACGGATGTTTGC
CCTGCAACTTCTTTATCCACAGAGATTGTATGTTTTTACCAAAGGTGATAAAGCTCACTCGTCACTCACACCGCTTGTTT
CATACTTTTCAAGTTCCTGATTACAACACGAACTGTCGAATATGTGGTGACCCGTTTGTTTGCGGAAGTGGAGGATATAT
TTGTACTGACGAGACGTGTGATTATAAACTTCACTCATATTGTGCAACGCATAAAAAGATTTGGGATGGCAAAGATGTGG
AGCGAGAACCTGAAGAAATTAGTAACTCTGAAGATGTTACGTTTTCATCGTTGGAGGAGGTAGATGGCAAAACAATCCGT
CATTTTAGTCATCACCATGATTTAGTGAGACAATATGTCAATGGTGGAGAAGAAGAAAACAAACGAGTATGCCAAGCATG
CATCCTTGGCATTGGCTCCGGTCCTTTCTTGGGTTGTAAAGAATGTGATTTTGCACTCCACGACACGTGTGCAAGGCTAC
CTCGGAAGATGGAACACCCTTTTCACCGCCATCCAATAACCCTAGAGGTGGACATGATGAACATCAAAGAAGGGTTCTTC
AGATGTTCTAAATGTGAACGAGAATCATGTGGTTTCATGTATCGATGCTGCCAAGAGGAATGTGAGTTTAAAATGGATAC
AAGGTGTGCTTCACTTGCTGATCCATTATACAATGGAGCCCACCAACACCCTCTCACTCTCTTAGGCCGTGGGGCACGTT
GTTACAAATGCGGTTTCTATTTGGATTCAGAACAAGCAACTCTGCCGGTGTTGGTAAAATGCAACTATGACATTCATCCA
CTTACCCTATTTTTAGGTATATCAATTAATATGTGGCCATGGAAGCCCTTTGCTTGTGAAGTCTGTGAACTAAGAATCAA
ACCTACTTATCCGGATTACCAAGATCTCTACGGCTGCTTCGACTGCGACACCGTTGTACACGTTGAGTGTGCAATAGGAA
AATACCCGTATCTGAAACCTGGCCATACGATCAAGTTGAATGGTTTTGAGATTGAGATTGCATCCAACAGTACTCTTTCT
CGGCCTATATGTCATGCATGTCACTCTATCTGCCAAGATAAACTGGTTTTCAATAATAAGAGCAGTGCCATCTCTTTCTG
TTCGATCAACTGTATAACCTCTTCATAG