Details for Chinese cabbage Locus Brara.E02754

Position : A05 ( 5`- 23884989 .. 23887648 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02754

Protein [Map View]
MGVSFSYPFTKQEDVEASLDSVTVKSISFGDDNECKTPKRSVNFSDKTLEPTILKSTGSGGKMVVEKSVSFKGMQLERMM
ENGFEIDNAEIARELSVLDPKNPKHEAAIKLQKVYKSFRTRRKLADCAVLVEQSWWKLLDFAELKRSSISFFDIEKHETA
ISRWSRARTRAAKVGKGLSKNGKAQKLALQHWLEAIDPRHRYGHNLHFYYNKWLHCQSREPFFYWLDIGEGKEVNLVEKC
PRLKLQQQCIKYLGPMERKAYEVVAEEGKFFYKSSGEMLHTSSMEESDSKWIFVLSTSKVLYVGKKKKGTFQHSSFLAGG
ATVAAGRLVVESGVLKAVWPHSGHYQPTEENFLDFLSFLRENNVDITDVKMSPTDEDEFSLYKQRSTHMRNHSLEEDLEP
EKSTILQDKVDPIQEETTPVMANIETPKKMESIKVSEDYDSGDDEEEEEEIFDLDQEPMPSELSSPRGGEETRESEVVKI
PEESILKRINSKKESRSFQLGKQLSCKWTTGAGPRIGCVRDYPSELQFQALEQVNLSPRSASVSRLCFSSLSHTQTPQMS
PLWRGMSLPADIITHS*

DNA
ATGGGAGTATCATTCTCCTATCCGTTCACCAAGCAAGAAGACGTGGAGGCTTCTCTAGACTCCGTCACTGTCAAGTCCAT
AAGCTTCGGTGATGACAACGAGTGCAAAACTCCCAAAAGATCCGTTAACTTCAGTGACAAAACTCTTGAGCCCACGATCT
TGAAATCTACGGGATCTGGTGGTAAAATGGTTGTCGAGAAGTCTGTCAGCTTCAAAGGGATGCAGCTGGAGAGAATGATG
GAGAATGGCTTCGAGATAGACAATGCAGAGATTGCTAGGGAACTCTCAGTTCTTGATCCGAAGAACCCTAAACACGAAGC
TGCTATTAAGTTACAGAAAGTTTACAAGAGCTTCCGTACGAGGAGAAAGCTTGCGGATTGTGCAGTGCTCGTGGAGCAAA
GCTGGTGGAAGCTATTGGATTTTGCTGAGCTGAAGAGAAGTTCTATATCTTTTTTTGATATTGAGAAACACGAAACCGCG
ATTTCGAGGTGGTCTAGAGCTAGGACTAGAGCAGCTAAGGTTGGTAAAGGTTTGTCCAAGAATGGAAAAGCACAAAAGCT
TGCTCTACAACATTGGCTTGAAGCTATTGACCCGAGGCATCGGTATGGACACAACCTGCACTTTTACTACAACAAATGGC
TCCACTGTCAGAGTAGAGAACCTTTCTTCTACTGGCTTGATATTGGAGAGGGAAAAGAAGTAAATCTTGTGGAGAAGTGT
CCTCGTTTGAAACTTCAGCAACAGTGCATCAAGTACCTTGGTCCGATGGAAAGGAAAGCTTATGAGGTTGTTGCGGAAGA
GGGCAAGTTCTTTTACAAGAGCAGTGGAGAAATGCTTCATACTTCTTCAATGGAAGAAAGTGATTCCAAATGGATTTTTG
TGCTGAGCACGTCGAAAGTGTTATATGTTGGGAAGAAGAAGAAGGGTACCTTTCAACATTCAAGCTTCTTAGCTGGAGGA
GCTACTGTTGCTGCAGGGAGATTAGTTGTTGAGAGTGGTGTTCTTAAGGCTGTTTGGCCACACAGTGGACATTATCAACC
TACAGAAGAGAATTTCTTGGACTTTCTTTCTTTCTTAAGAGAGAACAATGTTGATATCACTGATGTAAAGATGAGTCCTA
CAGATGAAGATGAGTTTTCTCTTTACAAACAAAGAAGCACTCACATGAGAAACCATTCTTTGGAAGAGGATTTGGAGCCT
GAGAAGAGCACTATCTTGCAAGACAAGGTTGATCCAATACAAGAAGAAACAACTCCGGTTATGGCTAATATCGAAACACC
GAAAAAAATGGAGTCTATTAAAGTATCTGAAGACTATGATTCTGGTGATGATGAGGAGGAAGAAGAAGAGATTTTTGACT
TAGACCAAGAACCAATGCCTTCAGAGCTGAGCTCACCAAGAGGAGGAGAAGAAACCAGAGAGAGTGAGGTAGTGAAGATT
CCAGAAGAATCAATCCTAAAAAGGATCAATTCAAAGAAGGAAAGTAGATCTTTCCAACTTGGGAAACAGCTATCTTGCAA
GTGGACAACAGGTGCAGGACCAAGGATTGGTTGTGTAAGAGATTACCCATCAGAGCTTCAGTTCCAAGCACTGGAACAAG
TCAACTTGTCTCCGAGAAGTGCTTCTGTTTCAAGACTATGTTTCTCCTCCTTGTCTCACACGCAAACGCCTCAGATGTCA
CCGTTATGGCGAGGAATGTCATTACCTGCAGATATCATCACACATTCATAA