Details for Chinese cabbage Locus Brara.E02749

Position : A05 ( 5`- 23866726 .. 23870683 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02749

Protein [Map View]
MPELRRGVRRGRVPDAVAPNQQPKDKNQRKSNGKAVAVGVTERPRTRLAARRLKEEDKKVTLKENLKDSDIEKKKGKEVV
VEEEEEEEEEEKEVMAIGNDSGGSNKAAAQEEEGNTAPFPERVQVGGSPLYKVERKLGKGGFGQVFVGRRISGGNDRSAG
ASILEVALKFEHRSSKGCNYGPPHEWQVYNTLGGSHGVPRVHFKGRQGDYYIMVMDILGPSLWDIWNTSGQAMSSEMVAC
IAVESLSILEKMHAKGYVHGDVKPENFLLGQPSTSQEKKLFLVDLGLATKWREGGGSGQHVEYDQRPDMFRGTVRYASAH
AHLGRTASRRDDLESLAYTLIFLHRGRLPWQGYQGDNKSFLVCKKKMATSPDMLCCFCPAPFKQFLEIVVNMKFDEEPNY
GKLVSLFQELLGENPAIRPINTEGAQKIIFQVGQKRGRLSIGEEEEDAPRKKVRLGVPATQWISIYNARQPMKQRYHYNV
ADSRLAQHIERGIADGLLISCVSSCSNLWALIMDAGTGFTNQVYELSPVFLHKEWIMEQWEKNYYISSIAGATNGSSLVV
MSKGTQYSQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGYRIT
STAATTDQAALILSIPRRRLADETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTVS*

DNA
ATGCCTGAGCTTCGCCGTGGAGTCCGCCGTGGCCGTGTCCCCGACGCTGTAGCTCCGAATCAACAGCCTAAGGATAAGAA
TCAGAGGAAGAGTAACGGAAAAGCGGTTGCCGTCGGAGTTACAGAGAGGCCGAGGACGAGATTGGCGGCGAGGAGATTGA
AAGAGGAAGATAAGAAGGTCACCCTTAAGGAGAATCTAAAGGATAGCGATATAGAGAAGAAGAAGGGTAAAGAGGTAGTG
GTTGAAGAAGAAGAAGAAGAAGAAGAGGAAGAGAAGGAAGTTATGGCGATTGGTAACGATAGTGGTGGCTCTAACAAGGC
GGCTGCTCAGGAAGAAGAAGGAAACACTGCTCCTTTCCCTGAAAGGGTTCAAGTTGGAGGATCACCGCTTTATAAGGTTG
AGAGGAAGCTGGGGAAAGGTGGTTTTGGGCAAGTGTTTGTAGGACGTCGTATTAGTGGTGGTAATGATCGTAGTGCAGGA
GCTAGCATCTTGGAGGTTGCTCTGAAGTTTGAGCATCGAAGCAGCAAGGGTTGCAACTATGGTCCTCCACATGAGTGGCA
GGTGTACAATACGTTGGGTGGCAGCCATGGAGTACCTAGAGTGCACTTCAAAGGGAGACAAGGAGACTATTATATTATGG
TAATGGACATACTCGGGCCTAGCTTGTGGGATATATGGAATACTTCAGGGCAAGCAATGTCCTCGGAAATGGTAGCTTGC
ATTGCAGTTGAATCACTGTCCATCCTTGAAAAGATGCATGCAAAAGGTTATGTGCATGGAGATGTTAAGCCAGAAAATTT
CTTACTCGGGCAGCCTTCAACGTCTCAAGAGAAAAAGCTGTTTCTTGTTGATTTGGGACTAGCAACAAAGTGGAGAGAAG
GAGGTGGTAGCGGACAACATGTTGAATATGACCAACGTCCCGATATGTTTAGGGGGACAGTTAGATACGCAAGTGCACAT
GCTCACTTGGGGAGAACTGCTAGCAGAAGGGATGATCTCGAATCATTGGCATATACACTGATCTTCCTTCACCGAGGTAG
ATTGCCATGGCAAGGATATCAGGGAGATAACAAGTCATTCCTCGTTTGCAAAAAGAAGATGGCAACATCGCCGGATATGC
TTTGTTGTTTCTGTCCTGCTCCTTTCAAGCAATTTCTTGAGATCGTGGTAAATATGAAATTTGATGAGGAACCTAACTAT
GGGAAGTTAGTATCTCTGTTTCAAGAACTCTTGGGGGAAAACCCGGCAATTAGGCCTATTAACACGGAGGGTGCTCAAAA
GATCATTTTTCAAGTTGGACAGAAGCGAGGTAGGTTGAGCATTGGGGAAGAAGAAGAAGATGCCCCTAGGAAAAAAGTCC
GTCTAGGAGTCCCTGCAACACAATGGATATCGATTTACAATGCCAGGCAACCAATGAAGCAGAGGTACCATTATAATGTA
GCTGATTCAAGGCTGGCACAGCATATCGAGAGAGGTATCGCAGATGGTTTGTTAATAAGCTGTGTATCATCATGTTCGAA
TCTATGGGCATTAATAATGGATGCTGGAACTGGCTTCACAAACCAAGTCTACGAACTTTCTCCTGTCTTCTTGCATAAGG
AATGGATAATGGAACAGTGGGAGAAGAATTACTACATAAGTTCTATTGCTGGTGCAACCAATGGAAGCTCCTTAGTTGTC
ATGTCAAAAGGTACGCAGTATTCACAGCAGTCTTACAAAGTAAGTGATTCATTCCCATTCAAGTGGATAAACAAGAAGTG
GAGAGAAGGCTTCCATGTAACCTCTATGGCAACAGCTGGGAGTCGATGGGGTGTTGTTATGTCCCGCAATTCTGGTTACA
GTGAGCAGGTTGTGGAACTGGATTTTCTGTATCCGAGTGAAGGCGTCCACAGGCGTTGGGATGGTGGATACAGAATTACA
TCAACCGCAGCAACAACAGATCAAGCTGCTCTAATTTTAAGCATCCCACGGCGTAGACTGGCTGATGAGACGCAAGAGAC
ATTGCGTACCTCTCAGTTCCCCAGCACACATGTCAAGGAAAAATGGGGAAAGAATCTCTACCTGGCATCTTTAAGTTATG
GCCGAACTGTGTCTTGA