Details for Chinese cabbage Locus Brara.E02746

Position : A05 ( 5`- 23846731 .. 23847724 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02746

Protein [Map View]
MTNYGAIPTSSHGSPVVDLDSVSRVKQQIKDGLATRRPWRVMFDFHSVGIPRGLSDAFSRIKKNLLYFQTNYAIVFLVVI
FLSLIKHPTSLIVLTVLVFVWIFLYFLRDEPIKLFSYQVDDKTVLVCLSVITIVLLFLTNATLNIAGALLIGAVLVLIHA
VVRKTDDLFLDEKAAMAETLA*

DNA
ATGACAAACTACGGCGCCATTCCGACGTCGTCTCACGGTTCCCCGGTGGTGGATCTCGACTCAGTCTCACGCGTCAAGCA
ACAAATCAAAGACGGGCTCGCCACGCGCCGCCCATGGAGAGTGATGTTCGACTTCCACTCCGTGGGGATCCCTCGCGGCC
TCTCAGACGCTTTCTCAAGAATCAAGAAGAACCTTCTCTACTTCCAGACGAACTACGCGATCGTCTTCTTGGTCGTGATC
TTCCTAAGCCTCATCAAGCATCCCACGTCGCTCATCGTCTTAACCGTGTTGGTCTTTGTCTGGATCTTCCTCTACTTCCT
CCGCGACGAGCCTATCAAGCTGTTTAGTTATCAGGTCGATGATAAGACGGTCTTGGTTTGTTTATCGGTGATAACTATCG
TTTTATTGTTTTTGACCAACGCGACGCTTAACATAGCTGGAGCGTTGTTGATCGGAGCTGTGTTGGTTTTGATCCATGCG
GTTGTTAGGAAGACGGATGATCTCTTCTTGGATGAAAAAGCGGCGATGGCTGAGACTCTTGCCTGA