Details for Chinese cabbage Locus Brara.E02745

Position : A05 ( 5`- 23842110 .. 23845344 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02745

Protein [Map View]
MDISSSLLLLSFFLFVIIIFIFNKINGLRTSSVSKKKLTDHVSTHSYGPRFPQGSLGWPILGETIEFVSSAYSDYPESFM
DKRQLMYGRVFKSHIFGTATIVSTDAEVNKAVLQSDSTAFVPFYPKTVRELMGKSSILLINGSLHRRFHGLVGSFLKSPP
LKAQIVRDMHKFLSESMDLWSEDQPVLLQDVSKNVAFKVLAKALISVEKGEELEELKEEFEQFIRGLMSLPINLPGTQLH
RSLQAKKKMVKQVEKIIGDKVRRAKNKEEDGAVAKDVVDVLLKGSSEKLTHNLIANNMIDMMIPGHDSVPVLITLAVKFL
SDSPTALHFLTEENMELKSLKEMTGEQLYWNDYLSLPFTQKVITETLRMGNVIIGVMRKAMKDVEIKGYVIPKGWCFLAY
LRSVHLDKLHYDSPYKFNPWRWQERDMNTSSFSPFGGGQRLCPGLDLARLEASIFLHHLVTRFRWVAEEDKIINFPTVHM
KNKLPIWIKRR*

DNA
ATGGATATTTCTTCATCACTTTTACTCTTGTCCTTCTTCCTCTTTGTCATCATTATCTTCATCTTTAACAAGATCAACGG
TCTCAGAACATCCTCAGTTTCAAAGAAGAAACTTACTGATCATGTTAGTACTCACAGCTACGGACCAAGGTTTCCACAAG
GAAGCTTGGGATGGCCTATCCTCGGAGAAACCATCGAGTTCGTCTCTTCTGCTTACTCTGACTATCCCGAGAGTTTCATG
GACAAGCGTCAACTTATGTATGGTAGAGTTTTTAAGTCGCATATATTTGGAACGGCCACGATCGTGTCGACGGACGCAGA
AGTTAATAAAGCAGTTTTACAGAGCGACTCCACGGCATTTGTGCCGTTCTACCCTAAAACGGTGAGGGAGCTCATGGGAA
AATCATCGATACTTCTGATAAACGGGAGTTTACACAGAAGGTTCCATGGATTAGTCGGTTCGTTCTTAAAGTCACCACCT
CTCAAAGCTCAAATCGTTAGAGACATGCACAAGTTTTTGTCCGAGTCCATGGATCTATGGTCCGAGGACCAACCTGTTCT
CCTCCAGGATGTCTCCAAGAATGTTGCATTCAAAGTACTTGCAAAGGCACTGATAAGTGTAGAGAAAGGAGAAGAATTAG
AAGAGTTGAAGGAAGAATTTGAACAATTCATCAGAGGACTCATGTCACTGCCAATTAACTTGCCTGGAACCCAACTTCAT
AGATCTCTCCAAGCTAAGAAAAAGATGGTGAAGCAAGTTGAAAAGATCATAGGAGACAAAGTCAGGAGAGCAAAAAACAA
AGAAGAAGATGGTGCGGTTGCAAAAGATGTTGTGGATGTGCTGCTTAAGGGCTCAAGTGAAAAATTAACTCACAATTTGA
TTGCTAACAATATGATTGACATGATGATTCCTGGCCACGATTCGGTACCTGTCCTCATCACTCTGGCTGTCAAATTTCTA
TCCGATTCTCCTACAGCTCTTCATTTTCTAACGGAAGAAAACATGGAGCTGAAAAGTTTGAAGGAGATGACAGGAGAGCA
ACTATATTGGAATGACTATTTGTCTTTACCTTTTACACAAAAGGTCATTACAGAGACACTGAGAATGGGAAATGTTATAA
TTGGAGTGATGCGAAAAGCGATGAAAGATGTTGAAATAAAAGGGTACGTGATACCAAAAGGATGGTGCTTCTTGGCTTAT
CTCAGATCAGTCCATCTTGATAAACTTCACTATGACTCCCCCTACAAATTCAATCCATGGAGATGGCAAGAAAGGGACAT
GAACACGAGTAGTTTCAGTCCTTTTGGAGGTGGCCAGAGGTTGTGTCCTGGTCTTGATTTGGCCCGTCTTGAAGCTTCAA
TTTTCCTTCACCATCTTGTCACTCGCTTCAGATGGGTTGCAGAAGAAGATAAAATTATAAATTTTCCTACAGTGCATATG
AAGAACAAACTACCCATTTGGATCAAAAGAAGATGA