Details for Chinese cabbage Locus Brara.E02744

Position : A05 ( 5`- 23837141 .. 23839000 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02744

Protein [Map View]
MVILSASSTVRAALDTQPRLPYNPNAPRKVKKTPNGNSFLPPPLPPPPSPRISISVDDLLKRPESKELSVEVDDSYMGYE
TWSPSPPKLEKPRSVFNAASLAFIGDSIYELYARRHFLFPPLSIEDYNDRVRAVVRCEAQYALLKKLIDDDFLTKEERDV
LRWGKNLGSARTRTRRRAGVAVYNKASSLETLIGYLYLTNGKRLEKIMEKLGFSSDSSTEIMIEMAKPKPSEPNLPSFIL
NEQVSTTVV*

DNA
ATGGTGATTTTATCTGCGAGCTCGACCGTGAGAGCTGCCTTGGATACACAGCCTAGACTCCCATACAACCCTAACGCGCC
TCGTAAAGTAAAGAAAACTCCTAACGGCAACTCTTTCTTACCGCCGCCTTTACCTCCTCCGCCGTCTCCGCGAATCAGCA
TCTCCGTCGACGATTTGCTCAAGCGACCCGAAAGCAAAGAGTTGAGTGTTGAAGTTGATGATAGTTACATGGGGTATGAG
ACGTGGTCTCCAAGTCCACCGAAGCTTGAGAAGCCAAGATCAGTCTTCAACGCTGCTTCTTTAGCCTTTATAGGTGATTC
CATTTATGAGTTATATGCTCGTAGGCATTTTCTTTTCCCTCCGCTTAGTATTGAAGATTATAACGATCGTGTTAGAGCTG
TGGTGCGCTGTGAAGCTCAGTATGCTTTGCTGAAGAAACTTATTGATGATGATTTCCTAACAAAGGAAGAGAGGGATGTA
CTCAGGTGGGGAAAGAATCTAGGCTCGGCTAGAACTCGTACAAGAAGGCGTGCAGGTGTTGCGGTTTATAACAAAGCATC
ATCACTGGAGACACTGATTGGTTATCTGTATCTGACGAATGGGAAAAGATTAGAAAAAATAATGGAGAAGCTAGGATTCT
CAAGCGACTCTTCGACTGAGATCATGATTGAAATGGCCAAGCCAAAACCATCAGAACCAAACCTGCCTTCCTTTATACTC
AATGAGCAAGTAAGCACCACAGTAGTATAG