Details for Chinese cabbage Locus Brara.E02740

Position : A05 ( 5`- 23813478 .. 23814990 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02740

Protein [Map View]
MEIEGEDGTKLILKPGDKSVFGRGAGFATDDLTVSRRHVSLELKPFAGGTDSDRVSLEVLGRNPVWVRKREPGEKIQTFR
KSETGEIKAGDRFCVSGQLPIWFTLKSRDERVSDGESGLDCIDSDPVKEFGFLVIGKEFDQYPKSRVRDVKQWEWFLEDS
SKRNSDDEDDDGGKKGRKGLSKKRRRRGKKGNEEDDDWSAESEEDKELMVKSKRVVSPIYSTRSKKTKKDVNASSSSSSS
RAQTKQRGSVDIDEEDEDEDDETLGGFIVSDEEAELEEEDEPNTDDEEELVEDDEDEDED*

DNA
ATGGAAATCGAAGGCGAAGACGGCACGAAGCTTATCCTGAAGCCCGGAGACAAATCCGTCTTCGGAAGAGGAGCCGGGTT
CGCCACCGACGACTTAACAGTGTCACGCCGCCACGTCTCCCTCGAGCTAAAACCCTTCGCCGGCGGAACCGATTCCGATA
GGGTTTCGCTCGAGGTTCTCGGTAGAAACCCGGTTTGGGTGCGGAAACGCGAACCGGGCGAAAAGATTCAAACTTTTCGT
AAGTCTGAGACTGGAGAGATCAAGGCCGGCGATAGGTTCTGTGTGTCGGGTCAACTCCCGATTTGGTTCACTTTGAAGAG
TCGCGATGAAAGGGTTTCGGATGGTGAAAGTGGTTTGGATTGTATCGATAGTGATCCTGTTAAAGAGTTTGGTTTTCTTG
TGATTGGGAAAGAGTTTGATCAGTATCCAAAGAGTCGAGTTCGCGATGTAAAGCAATGGGAATGGTTTCTTGAGGATTCA
AGCAAACGAAATAGCGATGATGAGGATGATGATGGAGGTAAGAAGGGAAGGAAGGGATTAAGTAAAAAGAGAAGAAGAAG
AGGAAAGAAAGGGAATGAGGAGGACGATGATTGGAGTGCGGAAAGTGAGGAAGATAAAGAGTTGATGGTCAAATCGAAAA
GAGTTGTGAGTCCAATTTACTCAACTAGATCCAAGAAGACTAAGAAAGACGTAAACGCAAGTAGCAGTAGTAGTAGTAGC
CGTGCTCAGACTAAACAGCGTGGAAGTGTAGATATCGACGAAGAAGATGAGGATGAGGATGATGAAACATTGGGAGGTTT
CATTGTTAGTGATGAAGAAGCTGAGTTAGAAGAAGAGGACGAACCAAATACAGATGATGAAGAAGAATTAGTAGAAGACG
ATGAAGATGAAGATGAGGATTAA