Details for Chinese cabbage Locus Brara.E02734

Position : A05 ( 5`- 23754963 .. 23755736 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02734

Protein [Map View]
MPSNKPSSIFPLHHKPTPLKPSSSTNTTNQACAACKYQRRKCAPDCLLAPYFPHDRHRQFLNAHKLFGVSNITKIIKDLS
PPEKDAAMHTIMFQSDARANDPIEGCYSIIRRLQYEIEYNKNELDMVLHQLAVFRDRAHNHYQEPHMQMQEPEDLSSSCD
LNNNNVIPYSYPLHHVQEPNQQQQQYCSSGNFNGLQEDMWCLQLQESSTTVNIKGGFIDECEDVKAVEEISNEFEHHDGF
VEDSKLDLPSAQFIVSS*

DNA
ATGCCCTCAAACAAACCATCTTCCATCTTCCCTTTACATCACAAACCAACACCATTAAAACCTTCAAGCAGTACCAACAC
CACAAACCAAGCATGCGCTGCATGCAAATACCAACGTAGAAAATGCGCTCCAGATTGTCTTCTCGCTCCTTATTTCCCTC
ACGACCGTCACCGCCAATTCCTCAACGCGCATAAGCTCTTTGGTGTCAGCAACATCACCAAGATCATCAAAGACCTTAGC
CCTCCTGAGAAAGACGCCGCTATGCATACAATCATGTTTCAGTCTGATGCTCGTGCCAATGATCCCATTGAAGGTTGCTA
TAGCATCATAAGAAGGCTTCAGTACGAGATCGAATATAATAAGAATGAATTGGACATGGTTCTTCATCAACTGGCTGTTT
TCCGTGACCGTGCTCATAATCATTATCAAGAACCGCATATGCAGATGCAAGAACCTGAGGATCTCTCGAGTTCTTGTGAT
CTAAACAACAACAATGTGATTCCTTACAGTTACCCTCTTCATCATGTCCAAGAACCAAATCAACAGCAACAACAATATTG
TTCTTCTGGAAACTTTAATGGGTTACAAGAAGACATGTGGTGTCTTCAACTTCAAGAATCATCAACGACAGTGAATATAA
AGGGTGGCTTCATTGATGAATGCGAAGACGTTAAGGCTGTAGAAGAGATTTCTAACGAGTTCGAGCATCATGATGGTTTC
GTTGAAGACAGTAAACTCGACCTGCCTTCCGCACAATTCATTGTTTCTTCTTAG