Details for Chinese cabbage Locus Brara.E02730

Position : A05 ( 5`- 23733705 .. 23734496 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02730

Protein [Map View]
MVMIQIVRPIASNHVSFHPDRRSSHYAHHHSPSRPTSGSTRGNYIEETEKGRKVGSNPPTIQVPTISSTPHLSPHYANYR
HEGLRYHCAT*

DNA
ATGGTGATGATACAAATAGTGAGGCCTATAGCTTCCAATCACGTTTCCTTTCATCCAGACAGAAGAAGTTCACATTATGC
ACATCATCACAGCCCTAGTAGGCCCACTTCAGGCTCAACAAGAGGAAATTATATAGAGGAGACTGAGAAAGGAAGAAAAG
TAGGATCAAATCCACCAACAATCCAAGTCCCTACCATTTCTTCAACTCCTCACCTTTCTCCTCATTATGCTAATTACCGG
CATGAGGGATTGAGATACCACTGTGCCACTTAA