Details for Chinese cabbage Locus Brara.E02729

Position : A05 ( 5`- 23732181 .. 23732453 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02729

Protein [Map View]
MDNYYKEPSASTASGNLPATDQTKDYQMKVKKSKSVQNADRGASRSWSFSDPESRRKRRVAGYKVYSVEQKMKGSIRKSF
KWFKDIIGIS*

DNA
ATGGATAACTATTACAAAGAACCATCAGCATCAACCGCATCTGGAAACCTCCCAGCTACCGATCAAACAAAAGATTACCA
GATGAAGGTAAAGAAAAGCAAAAGCGTTCAAAACGCGGATCGTGGAGCATCAAGAAGCTGGAGTTTCAGCGATCCGGAAT
CGAGGAGGAAGAGAAGAGTTGCTGGCTATAAGGTTTACTCAGTTGAACAGAAGATGAAAGGATCCATTAGAAAAAGCTTT
AAATGGTTCAAAGACATTATCGGTATTTCTTGA