Details for Chinese cabbage Locus Brara.E02728

Position : A05 ( 5`- 23725607 .. 23727927 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02728

Protein [Map View]
MAGSAPEGTQFDARQFDQKLNEVLEGQDEFFTSYDESHDSFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVI
QQAQSGTGKTATFCSGVLQQLDYSLVQCQALVFAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHV
VVGTPGRVFDMLKRQSLRADHIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITRKFMSKPVRI
LVKRDELTLEGIKQFYVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDII
MREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFYNVV
VEELPSNVADLL*

DNA
ATGGCAGGATCCGCACCAGAAGGCACTCAGTTTGATGCACGTCAGTTCGACCAGAAGTTGAACGAAGTTCTTGAAGGACA
GGATGAGTTCTTCACCTCTTACGATGAATCCCACGACAGCTTTGACGCCATGGGTCTCCAAGAGAATCTCCTCAGGGGTA
TCTACGCTTACGGTTTCGAGAAGCCTTCTGCTATCCAGCAAAGAGGAATCGTTCCCTTCTGCAAAGGCCTCGACGTGATC
CAGCAGGCTCAGTCCGGTACCGGCAAAACCGCCACTTTCTGCTCCGGCGTCCTCCAGCAGCTAGACTACTCCCTCGTCCA
GTGCCAGGCCCTCGTCTTCGCCCCGACCCGAGAGCTCGCCCAGCAGATCGAGAAGGTCATGAGGGCCCTCGGCGACTACC
TCGGCGTCAAGGTCCACGCCTGCGTCGGCGGGACCAGCGTCCGCGAGGACCAGCGCATCCTCCAGGCCGGCGTCCACGTC
GTCGTCGGCACCCCGGGGCGCGTGTTCGACATGCTGAAGCGCCAGTCCCTCCGCGCCGACCACATCAAGATGTTTGTCCT
TGATGAGGCCGACGAGATGCTCTCCCGCGGGTTCAAGGACCAGATCTACGACATCTTCCAGCTCCTCCCGCCGAAGATCC
AGGTGGGAGTGTTCTCTGCCACCATGCCGCCGGAGGCTCTTGAGATCACGAGGAAGTTCATGAGCAAGCCGGTGAGGATC
TTGGTCAAGCGCGATGAGCTTACTTTAGAAGGTATCAAGCAGTTTTACGTCAACGTTGAGAAGGAGGACTGGAAGCTCGA
GACGCTCTGCGACCTCTACGAGACGCTAGCCATCACTCAGAGCGTCATCTTTGTCAACACTAGGCGGAAGGTGGACTGGC
TCACTGATAAAATGAGGGGGCGTGACCATACAGTCTCTGCGACTCACGGAGACATGGACCAGAACACTAGAGACATTATC
ATGAGAGAGTTCAGGTCTGGCTCATCTCGTGTGTTGATCACGACTGATCTCTTGGCTCGTGGTATCGATGTTCAGCAGGT
GTCTCTGGTGATCAACTACGATCTGCCGACTCAGCCTGAGAACTACCTTCACCGTATTGGAAGAAGTGGGAGGTTTGGGA
GGAAAGGAGTGGCGATCAACTTTGTGACCAAGGATGATGAGAGGATGCTGTTTGATATTCAGAAGTTTTACAACGTGGTT
GTTGAGGAGCTGCCTTCGAACGTTGCTGATCTGCTGTGA