Details for Chinese cabbage Locus Brara.E02723

Position : A05 ( 5`- 23703608 .. 23704884 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02723

Protein [Map View]
MSSVRKIVVHLRATGGAPILKQNKFKISGTDKFAKVIDFLGRQLHSDSLFVYVNSAFSPNPDESVIDLYNNFGIDGKLVV
NYACSMAWG*

DNA
ATGAGCTCCGTTCGGAAAATTGTTGTTCATCTAAGAGCTACAGGAGGTGCTCCGATACTGAAACAAAATAAGTTCAAGAT
TTCAGGGACGGATAAGTTTGCTAAAGTGATTGATTTTCTAGGAAGGCAGCTTCACTCTGACTCATTGTTTGTGTATGTAA
ACAGTGCTTTCTCGCCAAACCCTGATGAGTCAGTAATTGATCTATACAATAACTTTGGGATAGATGGGAAACTGGTGGTG
AACTATGCTTGTTCCATGGCATGGGGATAA