Details for Chinese cabbage Locus Brara.E02721

Position : A05 ( 5`- 23685156 .. 23690050 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02721

Protein [Map View]
MVSGSRTGGNRAMDDGDRKLIESIREIVGNHTDADIYAALKEADMNADEAVQKLIHQDPFHEVKRRRDRKKEVAVLVEPA
DEKKPLESVTSEVNVRTQPEHNARRGGYSRNVFPRNAAPRDDFHRNTAPRNELPRNAAPRNEFPRNAAQQHEFPGNPAPR
NAFLRNAAPRNAFPRNPATGSKKEFRVVRDNRSNPNVGEELKYTSAHQSSGLNISKVMASQNQKGLTGGVGNRRSPGDQD
FSKDCNAVADVRLRDSEIAPLHHPTRKELSDGKQTARSVTLPSTNSVIGVYPSSTDPVHVPSPVSRSSPVGAIKREVRGG
GFGGKPSENVGKNPSASAGSLSGSSIRKIGTPNAHRSSSPNSKIDQVSQTTLRESVLPSGGEKNRPVLNRQRGNRGSQNA
RTQQVGGHTKGVSQNKEWKPKPIQKSVGHNPGVIGTPAKSQACRSDDISLNLESEAVKVQDKLSHVHISESQNVIIADHI
RVPETDRCQLTFGSFVQEFSSSVNSEPAFQESCSLEELRETDRSSPVSSPETLTDGPGDKPIDILDDHVRVSESDSRVSV
ASEHQLPEEKEAHRSDNLDEYSEIQLLNRNGPHYTPLEFEEQQDPPELQKAPAYGNHGSYDSPYENVRGQGLPSQQEVLS
TQMVNNGPSSTIPMLQQQQQQQQQASMQQMYPQVQVAHFPNLMPYRQFVSYVPQMPMPGYSGNPAGYAHPSNGNSYVLMP
GGGSHPGSNGVKYGIQQFKPVPTGGPTGFGTYNNNPNAYQINTPNVVGNAMGLEDPSRMKYKDGNIYVQNPQQPETSDIW
MQNPRDLSSLQSPPYYNVAGQTPHGAYLPSHTSHPSFNAAAQSPQMQFQGLFHPPQPGAMANQHHMGPGLGGNVGVVPSP
PSQLGAYQQSQLGHPNWGANF*

DNA
ATGGTGTCTGGGTCCAGAACCGGCGGTAATCGGGCGATGGATGATGGAGATAGAAAGCTGATTGAGTCGATTAGAGAAAT
CGTGGGTAATCACACCGACGCCGATATCTACGCCGCCTTGAAAGAAGCTGACATGAACGCCGACGAGGCTGTGCAGAAGC
TGATTCATCAAGATCCGTTCCATGAGGTGAAGAGAAGAAGAGACAGGAAGAAAGAGGTTGCAGTATTGGTTGAGCCTGCC
GACGAAAAGAAACCTCTTGAAAGTGTTACCAGTGAGGTGAACGTTCGTACACAGCCTGAGCATAATGCTCGGAGAGGAGG
CTACAGTAGGAATGTCTTCCCTAGGAACGCTGCTCCACGAGATGATTTTCATAGGAACACTGCTCCGCGAAATGAACTTC
CTAGGAACGCTGCTCCACGAAATGAGTTTCCTAGGAACGCTGCTCAACAACATGAGTTTCCTGGGAACCCTGCTCCACGT
AATGCCTTTCTTAGGAACGCTGCTCCACGAAATGCATTTCCTAGGAATCCTGCTACTGGATCCAAGAAAGAGTTTCGTGT
TGTTAGAGACAATAGGTCTAATCCAAATGTTGGTGAAGAGTTGAAGTATACTTCCGCTCACCAGTCTTCTGGATTAAACA
TTAGCAAAGTAATGGCCTCTCAGAACCAAAAGGGCTTAACAGGTGGTGTAGGCAATCGTCGATCTCCTGGGGATCAAGAT
TTTTCAAAAGATTGTAATGCAGTAGCAGATGTCAGGCTCAGAGATTCTGAAATTGCTCCATTGCACCATCCAACCAGAAA
AGAACTCTCTGATGGAAAGCAGACGGCCCGTAGTGTTACCTTGCCATCAACCAATTCAGTTATTGGTGTATATCCGTCTT
CCACAGATCCAGTTCATGTACCATCTCCTGTTTCTAGATCATCACCTGTGGGAGCTATTAAACGTGAAGTAAGAGGTGGA
GGCTTTGGTGGAAAACCTTCTGAAAATGTTGGTAAAAATCCATCTGCATCTGCGGGTTCTTTGTCAGGGTCCTCGATTAG
AAAGATTGGGACTCCAAATGCACATCGATCATCTTCCCCAAATTCAAAGATTGATCAAGTCAGTCAAACTACTTTACGAG
AGTCTGTTTTACCCAGCGGTGGGGAAAAGAATAGACCTGTTTTGAACAGGCAGCGTGGAAACAGAGGAAGCCAAAATGCT
AGAACACAACAAGTTGGTGGTCATACAAAAGGAGTCTCACAGAACAAGGAATGGAAACCTAAACCAATTCAGAAATCTGT
TGGACATAACCCTGGAGTAATTGGAACACCTGCAAAGTCTCAGGCTTGTCGTTCTGATGATATTTCCTTAAACTTGGAAT
CGGAGGCTGTTAAGGTGCAAGATAAGCTTTCGCATGTTCATATCAGTGAAAGCCAGAATGTCATCATCGCAGATCATATT
CGCGTCCCAGAGACTGACCGATGTCAGCTTACTTTTGGTAGCTTTGTTCAGGAGTTTAGTTCTTCAGTGAATTCAGAGCC
TGCTTTCCAGGAATCATGCTCTTTAGAAGAACTTAGAGAAACTGATCGTAGTTCGCCAGTTTCTTCTCCAGAGACATTAA
CAGATGGTCCGGGGGATAAGCCTATTGATATTCTTGATGATCATGTCAGAGTTTCTGAATCTGACTCACGTGTGTCGGTG
GCATCTGAGCATCAGTTACCCGAAGAGAAGGAAGCTCACAGATCTGACAATTTGGATGAGTACTCGGAAATTCAATTGCT
CAATAGGAACGGTCCACATTATACTCCTTTAGAGTTTGAAGAGCAGCAAGATCCTCCTGAGTTGCAAAAAGCTCCTGCAT
ATGGTAATCACGGTAGTTATGACTCTCCGTATGAAAACGTACGAGGACAAGGATTACCATCTCAGCAAGAGGTGTTAAGT
ACTCAAATGGTGAACAATGGCCCTTCATCTACGATTCCCATGCTGCAGCAGCAGCAACAACAACAACAGCAGGCGTCAAT
GCAACAGATGTACCCGCAGGTTCAAGTTGCACATTTTCCCAATCTGATGCCTTATCGTCAGTTCGTCTCCTATGTTCCCC
AGATGCCCATGCCAGGCTACTCAGGTAACCCAGCAGGGTATGCACACCCTTCAAATGGAAATAGCTATGTTCTAATGCCT
GGAGGTGGTTCTCATCCTGGCTCAAACGGTGTCAAGTATGGCATCCAGCAATTCAAGCCAGTCCCAACAGGTGGTCCTAC
TGGTTTTGGGACTTACAACAACAACCCTAATGCGTATCAGATTAATACTCCCAATGTAGTTGGAAACGCCATGGGTCTTG
AAGATCCATCTCGCATGAAATACAAAGATGGGAATATCTACGTTCAAAACCCTCAGCAGCCTGAGACTTCTGATATTTGG
ATGCAGAATCCAAGAGATCTTTCAAGCCTTCAGTCTCCTCCATATTACAACGTAGCTGGTCAAACGCCTCATGGTGCTTA
TTTACCATCCCATACATCACATCCATCCTTCAACGCCGCTGCACAATCTCCTCAAATGCAGTTCCAGGGTCTCTTCCATC
CCCCACAACCTGGTGCAATGGCGAATCAACACCACATGGGACCTGGGCTTGGTGGTAATGTTGGGGTTGTACCCTCTCCC
CCCTCTCAACTTGGTGCTTATCAGCAATCACAACTTGGTCATCCCAATTGGGGAGCAAACTTCTGA