Details for Chinese cabbage Locus Brara.E02716

Position : A05 ( 5`- 23657181 .. 23659430 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02716

Protein [Map View]
MSAVHFLFSSKNPKFRGIFNGLCALILFVFFFDRSEILNNPLLKKASFLSKGKLNTNGFTHYRHMIEEDVSKFGNESFSS
TSTVLCSGLHNHIGYADQCDFLRANPSCSPDGFFDYLTFFYCSCRDFKILGYMILGVWLVALFYLLGNTAADYFCCSLEK
LSKLLRLPPTLAGVTLLPLGNGAPDVFASIAAFVGSDKGEVGLNSVLGGAVFVTSVVVGIVSLCVADMEVKLDKKCFIRD
LSFFLFSLVSLMVILMVGEVTVRIAVAFVSIYVVYAFLVAANVILRKHAKRFKIEAITPLLPMQGSVFSPSVGEDVPIHS
PLIESDSEDGPPRLLNSLPQWMWASNVAIYSNHFARGSSVQDDDRPPWGWIEDGVETESSLCNKFTSLLEIPLTVPRKLT
IPSVEEDTWSKTYAVASVTLAPLLLASLWSSQENVSPQACGVAYFISIAIGSALGFFAYKNTEPDHPPRRFLIPWVLGGF
IMSIVWFYMIANELVALLVTFGEIYGINPSILALTVLAWGNSMGDLVSNIALSMNGGDGVQIALSGCYAGPMFNTLVGLG
MSMLLGAWSKSPDPYMVPEDKSLFYTLGFLVLGLVWAMVMLPRNNMQPNKTLGIGLIALYLIFVTFRLSCAMGFIPWAA*

DNA
ATGAGTGCTGTGCATTTTCTTTTTAGCTCCAAAAACCCTAAGTTTCGAGGGATTTTCAACGGACTTTGTGCTTTGATTCT
ATTCGTCTTCTTCTTCGATCGGAGCGAAATTCTCAACAACCCTTTGTTAAAGAAAGCATCTTTCCTCTCCAAAGGTAAAC
TCAACACCAATGGTTTCACCCATTATCGACACATGATCGAAGAAGATGTTTCCAAGTTTGGCAATGAAAGCTTCAGCAGC
ACTAGTACTGTCTTATGCTCGGGTTTACATAACCACATCGGTTACGCTGACCAATGCGACTTCTTAAGAGCGAACCCGAG
CTGCTCACCTGATGGGTTCTTTGACTACCTCACCTTCTTTTACTGCTCCTGCAGAGACTTCAAGATCTTGGGCTACATGA
TCCTCGGCGTTTGGCTCGTTGCCTTGTTTTATCTCTTGGGTAACACCGCTGCTGATTACTTTTGTTGCTCCCTTGAGAAG
CTCTCTAAGCTTCTGAGGCTGCCTCCTACTCTTGCCGGCGTTACTCTGCTTCCTCTAGGGAACGGGGCTCCGGATGTGTT
CGCGAGTATAGCTGCTTTCGTCGGTTCGGATAAAGGAGAAGTTGGTCTTAACAGCGTCCTTGGTGGTGCTGTTTTCGTCA
CTTCCGTTGTTGTTGGGATTGTTTCGCTTTGTGTTGCGGATATGGAGGTGAAGCTTGATAAGAAGTGCTTTATTAGAGAC
TTGAGTTTCTTCCTTTTCTCGCTTGTGTCTCTGATGGTGATTCTGATGGTTGGGGAGGTGACGGTGCGGATTGCTGTTGC
GTTTGTTTCGATATATGTTGTTTATGCTTTTCTTGTGGCGGCGAATGTGATTCTGAGAAAGCATGCTAAGAGGTTTAAGA
TAGAGGCGATCACTCCTTTGTTACCTATGCAAGGGAGTGTTTTTTCGCCGAGTGTTGGAGAGGATGTTCCGATTCATAGC
CCCTTGATTGAGAGTGACTCTGAGGATGGTCCGCCTCGGCTGCTGAACTCTCTTCCTCAGTGGATGTGGGCTTCTAATGT
GGCTATCTATTCAAACCATTTCGCGAGAGGTAGTAGCGTGCAAGATGATGACAGACCACCTTGGGGATGGATTGAAGACG
GTGTGGAAACTGAGAGCTCATTGTGTAATAAATTCACTTCTTTGTTGGAGATCCCACTGACGGTTCCGAGGAAGTTAACG
ATTCCATCGGTGGAGGAAGATACATGGTCGAAGACATACGCTGTGGCCAGCGTTACGTTAGCGCCTCTGCTTCTGGCGTC
TCTATGGAGTAGCCAAGAGAATGTGAGTCCACAAGCTTGTGGTGTGGCTTACTTTATCAGCATAGCTATTGGCTCTGCTC
TTGGGTTTTTTGCTTACAAAAACACAGAGCCGGATCACCCGCCTCGGAGATTCTTGATCCCTTGGGTTCTCGGTGGGTTT
ATCATGAGCATCGTATGGTTCTACATGATTGCAAACGAGCTTGTTGCACTTCTAGTAACATTCGGTGAGATCTACGGTAT
CAACCCGTCGATACTTGCGCTAACAGTACTCGCTTGGGGAAACTCAATGGGTGACTTAGTGTCGAACATTGCGTTGTCGA
TGAATGGTGGGGACGGTGTACAAATCGCTCTATCGGGATGCTACGCAGGTCCAATGTTCAACACACTGGTCGGACTTGGT
ATGTCAATGCTTCTCGGCGCATGGTCCAAGAGTCCTGACCCTTACATGGTCCCGGAAGATAAAAGCCTGTTCTACACTCT
TGGGTTTCTAGTACTCGGTTTGGTTTGGGCTATGGTGATGCTTCCGCGCAACAACATGCAACCAAACAAAACCTTAGGTA
TTGGACTCATTGCTTTATATCTGATATTCGTCACTTTCAGGCTCAGCTGCGCCATGGGATTTATACCATGGGCTGCTTAG