Details for Chinese cabbage Locus Brara.E02712

Position : A05 ( 5`- 23643810 .. 23644765 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02712

Protein [Map View]
MEMDMDTSPSFFDPEVLTVRDQFRRYGKRHSTSPHEEFSSPNVSENRLLYDGHSIHSPTNTALLLENIKEEVDNFHTDLY
QGTPANPLSASKRESAGIMDGDDEALFRRVESQSLKACKIENDELAESGDTTFALFASLFDSALQGLMPIPDLILRLEES
CRDVSQSIR*

DNA
ATGGAGATGGATATGGACACTTCTCCTAGCTTCTTCGACCCCGAGGTCCTCACTGTTAGGGATCAGTTCCGTCGTTATGG
GAAGAGACACTCTACATCGCCACATGAGGAATTCTCGAGTCCGAATGTCAGTGAGAACCGGTTACTGTATGATGGGCATT
CCATCCATAGTCCAACAAACACAGCCTTGCTTCTTGAAAACATTAAAGAAGAGGTTGACAACTTTCACACCGATCTTTAC
CAAGGGACACCTGCGAATCCGCTCTCTGCTTCCAAGAGGGAGAGTGCTGGAATTATGGATGGTGATGACGAGGCTTTGTT
TCGACGAGTTGAAAGTCAGTCACTGAAGGCTTGCAAGATTGAGAATGATGAGTTGGCCGAGAGTGGAGATACGACCTTTG
CTCTCTTTGCTTCCCTGTTTGATTCTGCTCTTCAAGGACTCATGCCCATTCCAGATCTTATATTAAGACTTGAGGAGTCA
TGCAGGGATGTTTCACAATCAATTAGGTAA