Details for Chinese cabbage Locus Brara.E02698

Position : A05 ( 5`- 23551300 .. 23553561 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02698

Protein [Map View]
MVGKCDFVSVIGAILVLTIFHNPNIVHAGEGVPEVALFTFGDSYYDAGNKAFLSKKKNPPQTQWPYGKSLDDPNGKFSDG
HIVPDFIGDFISIPNGIPPALKPGANLSRGASFAVADASILGAPVESMTLNQQVNKFRSMKSNWTDDYIEKSLFMIYIGT
EDYLNFTKTNPTADASAQQAFVISVTNKLKNDIGLLYSLGASKFMVQLLAPLGCLPIMRQEHGTGNDCYEPLNDLAKQHN
EKIGPMLNQFAKSPGFQFTVFDFYNAILRRTQRPHNYRFYVANSSCCGVGTHTAYGCGMGNVHSKLCEYQRSYLFFDGRH
NTEKAQEELAHLIYGADTNVIQPMTVRELIVFPAGANMLESWEPNLSSVRRRPSTKSTSVYRLLDLVG*

DNA
ATGGTAGGAAAGTGTGATTTTGTGAGTGTTATAGGAGCCATACTGGTACTAACCATCTTCCATAATCCGAACATCGTCCA
CGCCGGCGAGGGTGTTCCGGAGGTAGCGTTGTTCACTTTCGGAGACTCTTATTACGACGCCGGAAACAAAGCGTTTCTAA
GCAAAAAGAAAAATCCTCCACAAACCCAATGGCCTTATGGCAAATCCCTTGACGACCCTAACGGCAAGTTTTCCGACGGC
CACATTGTCCCCGATTTTATCGGTGACTTCATATCCATACCGAACGGAATCCCGCCTGCACTTAAACCAGGCGCTAATCT
TTCACGTGGAGCTAGTTTTGCCGTCGCTGATGCTTCTATCCTTGGAGCTCCGGTGGAATCTATGACACTGAATCAACAAG
TGAACAAGTTCAGAAGCATGAAATCAAATTGGACCGACGACTACATCGAGAAATCACTGTTTATGATATACATCGGTACA
GAAGATTATTTGAACTTCACCAAGACCAATCCCACTGCAGACGCTTCTGCTCAGCAAGCTTTTGTCATTTCCGTCACGAA
CAAATTAAAGAACGACATCGGCTTGTTATACTCCTTGGGAGCCAGTAAGTTCATGGTTCAATTGCTAGCACCATTGGGTT
GTTTACCGATCATGAGACAAGAACATGGAACCGGCAACGACTGTTACGAGCCACTTAACGATTTGGCCAAACAACACAAC
GAGAAGATCGGTCCGATGTTGAACCAGTTTGCCAAATCCCCTGGTTTTCAATTCACCGTCTTTGATTTCTACAACGCCAT
CCTTCGGAGGACACAGAGACCTCATAACTACCGGTTCTACGTGGCGAACTCATCATGTTGTGGTGTTGGGACGCACACTG
CGTACGGTTGCGGAATGGGAAACGTTCACTCGAAACTATGTGAGTATCAAAGGTCGTATCTCTTCTTTGACGGACGTCAC
AACACAGAGAAGGCCCAAGAGGAACTAGCTCATCTGATCTATGGAGCTGACACTAATGTGATCCAACCGATGACGGTCCG
TGAGCTAATTGTGTTTCCAGCTGGAGCGAACATGCTTGAGTCTTGGGAGCCTAACTTGTCCTCGGTCCGTCGTCGTCCAT
CTACTAAATCTACATCAGTTTATCGACTTCTTGATTTAGTTGGATGA