Details for Chinese cabbage Locus Brara.E02692

Position : A05 ( 5`- 23522518 .. 23523415 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02692

Protein [Map View]
MAYSIKLCLPLQTPCSAPKTVRSKTLMLQQSQVQVKVKQVTVSQPQPIRYSTKKNTVFEDPIQGIICYTDDNGEVICEGY
DEGPRCPPDSSMVASHSREVEILDLLQRSYQELRVTYKGDGQRHEIASRQELAMIKWSNYDFL*

DNA
ATGGCATATTCAATTAAACTCTGTCTTCCTCTTCAAACACCATGTTCTGCTCCAAAGACAGTAAGATCAAAGACTTTGAT
GCTTCAACAGAGTCAGGTTCAAGTTAAAGTCAAGCAAGTAACAGTTTCACAGCCTCAACCGATAAGATACTCCACCAAGA
AGAACACTGTGTTCGAAGATCCAATCCAAGGGATCATATGTTACACAGATGATAATGGAGAAGTTATATGTGAAGGGTAC
GATGAAGGTCCTCGTTGTCCACCAGACAGCTCAATGGTAGCTTCTCACTCAAGAGAGGTGGAGATTCTTGATCTTCTGCA
AAGAAGTTATCAGGAACTGAGAGTTACATACAAGGGTGATGGTCAAAGACATGAAATTGCTTCACGACAAGAGTTAGCAA
TGATCAAATGGAGCAACTATGACTTTCTCTAA