Details for Chinese cabbage Locus Brara.E02690

Position : A05 ( 5`- 23508503 .. 23511620 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02690

Protein [Map View]
MNEDQEIALFMATMATFGCVVLLCLCCMESRRGNNSHPTQPNRRFHELIQDIKPTINYKPPAPPPIPVVKFNSHNFKNVV
ECVVCLSNLVDGDKARVMPTCKHCFHVDCIDKWLKCNSICPVCRINVVGRLALNDGSIFQSLPSIGANSVMDMDSSAESE
TRDGQ*

DNA
ATGAACGAAGATCAAGAAATTGCCTTATTCATGGCGACTATGGCTACGTTTGGTTGTGTAGTGCTATTGTGTTTATGCTG
TATGGAGTCTCGTAGGGGCAACAATAGTCATCCAACTCAACCCAATCGTAGATTTCATGAGCTAATCCAAGACATCAAAC
CCACCATCAACTATAAACCTCCCGCTCCTCCACCAATCCCCGTGGTGAAGTTCAACTCTCATAACTTCAAAAACGTTGTC
GAGTGCGTTGTTTGCCTCTCCAACCTAGTCGATGGAGACAAAGCCAGGGTTATGCCGACATGTAAACACTGCTTTCACGT
GGATTGCATCGACAAGTGGCTTAAATGTAATTCCATTTGTCCTGTCTGCAGAATAAACGTTGTTGGTCGTTTGGCCCTAA
ATGACGGCTCGATTTTTCAATCTCTTCCGAGTATAGGAGCTAACTCTGTGATGGATATGGATAGTTCGGCCGAATCAGAA
ACTCGAGACGGCCAATAA