Details for Chinese cabbage Locus Brara.E02686

Position : A05 ( 5`- 23495522 .. 23496170 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02686

Protein [Map View]
MAEFKRKFNKGHAFTSKCVSLVKEQRARLYILRRCATMLCCWYIHGDE*

DNA
ATGGCCGAATTCAAGAGAAAGTTCAACAAAGGTCATGCCTTCACAAGCAAATGTGTTTCCTTGGTGAAGGAACAACGGGC
TCGTCTCTATATTCTCCGCCGTTGCGCCACCATGCTTTGCTGCTGGTACATCCATGGCGATGAATAG