Details for Chinese cabbage Locus Brara.E02684

Position : A05 ( 5`- 23474566 .. 23475380 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02684

Protein [Map View]
MDKTDQNVNRTERTVESVLRVASMALSIASLVIMIKNSIANDFGSPSYSTLGAFKYLVTANGVCAAYSVLSAIFVIAIPC
PISKPRLWTLFLLDQVVTYVVLAAGAVSAETVYLAYKGNLNITWSSACDYYGIFCHKALVSVILTFLVSVLYVSLSFISS
YRLFSRFEAPKH*

DNA
ATGGACAAGACTGATCAAAATGTTAACCGAACGGAGAGAACGGTAGAGTCGGTCCTGAGAGTCGCATCAATGGCTCTAAG
TATTGCGAGTCTCGTGATCATGATCAAAAACTCTATCGCCAATGACTTTGGCTCTCCTTCTTACTCAACTCTTGGAGCTT
TCAAGTATTTGGTGACTGCTAATGGAGTTTGTGCGGCATATTCTGTTCTTTCTGCTATCTTTGTAATAGCCATTCCGTGT
CCTATAAGCAAGCCCAGACTCTGGACATTGTTCTTGCTTGATCAAGTGGTCACGTATGTGGTTCTAGCGGCTGGGGCTGT
ATCTGCAGAGACGGTATACTTAGCATATAAAGGAAACTTAAACATCACTTGGAGCTCTGCTTGTGATTATTATGGAATCT
TCTGTCACAAGGCACTAGTCTCAGTTATATTAACATTCCTTGTTTCTGTTCTTTACGTGTCACTTTCATTCATCTCTTCC
TATAGACTCTTTAGCAGATTCGAAGCACCTAAGCATTGA