Details for Chinese cabbage Locus Brara.E02683

Position : A05 ( 5`- 23468946 .. 23469621 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02683

Protein [Map View]
MEAVKTTRFSTEVAPSKLISATTREPFKSMLTTIFEEELDFDELVRATAERLSSSCPGFSSWSLGHYAKTNSLSAS*

DNA
ATGGAAGCAGTTAAGACCACCAGGTTCAGCACCGAGGTGGCTCCCTCTAAGTTGATATCCGCAACGACGAGAGAACCATT
TAAGAGCATGTTGACCACAATCTTCGAGGAAGAGTTGGACTTTGACGAATTAGTCAGAGCCACTGCAGAGAGACTCTCTT
CATCTTGTCCAGGCTTCTCCTCCTGGTCTCTTGGTCACTACGCCAAGACCAATAGTCTCTCTGCTTCTTAG