Details for Chinese cabbage Locus Brara.E02681

Position : A05 ( 5`- 23460861 .. 23463268 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02681

Protein [Map View]
MADRSRGFMRDEFVTYAYILLYIALSSGQIFFNKWVLSSKEINFPYPLGLTLLHMIFSSVLCFLLTKVLKIVKVEEGMTL
EIYVTSVIPIGAMFAMTLWLGNTAYLYISVAFAQMLKAIMPVAVFILGVAAGLEMMSCRMLLIMSIISFGVLVASYGELN
INWIGVVYQMGGVVGEALRLIFMEILVKRKGIKLNPISLMYYVSPCSAVCLFVPWIFLEKSKMDGNGPWNFHFVVLTLNS
LCTFALNLSVFLVISHTSALTIRVAGVVKDWVVVLVSALLFADTKLTVINLFGYAIAIAGVAAYNNHKLKKEASRVTSET
PGDGESIPLVSLPNTERG*

DNA
ATGGCGGATCGGAGCAGAGGATTCATGAGAGATGAATTCGTGACCTACGCTTACATTCTTCTCTACATCGCTCTTTCTAG
CGGTCAAATCTTCTTCAACAAGTGGGTTTTGTCATCTAAGGAAATAAACTTTCCTTATCCGCTTGGATTGACTTTGCTCC
ACATGATCTTCTCCTCTGTCTTGTGCTTTCTTCTTACCAAAGTTCTCAAGATCGTGAAGGTTGAGGAAGGAATGACATTA
GAAATATATGTTACATCAGTTATTCCAATAGGTGCCATGTTTGCGATGACCCTCTGGTTAGGAAACACTGCCTACCTCTA
CATCTCAGTTGCATTTGCCCAGATGTTGAAGGCTATAATGCCTGTTGCTGTGTTTATCCTTGGAGTAGCTGCTGGGCTTG
AAATGATGAGCTGCAGGATGCTTTTGATTATGTCTATCATAAGTTTCGGCGTTTTAGTAGCCTCGTATGGGGAGTTGAAC
ATCAACTGGATCGGAGTTGTTTACCAAATGGGTGGCGTCGTTGGAGAAGCACTGAGGCTGATCTTCATGGAGATTCTTGT
CAAGAGGAAAGGCATCAAGCTAAACCCAATCTCTCTTATGTACTATGTGAGCCCCTGCAGTGCTGTTTGCTTGTTTGTAC
CGTGGATCTTTCTAGAGAAGTCGAAGATGGATGGCAATGGCCCGTGGAACTTCCATTTCGTAGTGCTGACACTTAACTCC
CTCTGTACATTTGCTCTCAACTTGTCGGTTTTCTTGGTGATCTCTCACACGAGCGCTCTCACTATCCGAGTCGCTGGCGT
TGTCAAGGATTGGGTGGTTGTTTTGGTCTCAGCTCTTCTCTTTGCCGACACAAAACTCACAGTCATCAATCTTTTTGGTT
ATGCCATTGCTATTGCCGGTGTGGCAGCTTATAACAACCATAAGCTGAAGAAGGAAGCATCTCGAGTTACCTCCGAAACT
CCAGGAGATGGTGAGTCGATACCGTTGGTGTCACTACCTAATACAGAGAGAGGATGA