Details for Chinese cabbage Locus Brara.E02678

Position : A05 ( 5`- 23442460 .. 23443105 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02678

Protein [Map View]
MIGRRAGTNRAGMRRDDSILTRFVDSVFSLFRLAEFEILFVLFFVIAYVIFKDLTARPEYNRILVEKPRGYDVWPF*

DNA
ATGATCGGACGGCGTGCTGGAACGAATCGAGCTGGCATGAGGAGGGACGACTCCATCCTGACTCGGTTCGTTGACTCAGT
GTTTTCTCTATTCCGATTAGCCGAGTTTGAGATCCTGTTTGTGCTATTCTTCGTTATAGCCTACGTCATCTTCAAAGATC
TGACGGCGAGGCCGGAGTACAATCGGATTCTTGTTGAGAAGCCTCGTGGATATGACGTATGGCCGTTCTAG