Details for Chinese cabbage Locus Brara.E02675

Position : A05 ( 5`- 23399778 .. 23403860 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02675

Protein [Map View]
MIVGEMVLSAFLQALFQTLMSGPFKSFFKRRELNECVLERLNIALLTISAVLIDAEEKQITNPSVEKWVNELRDVVYHAE
DALDDIATEALRLNIGAESSSNRLRQLRVRTLADFLEGNSDHLETRLEKVTMRLERLASQRNILGLKEITAMTPKQRLPT
TSLVDESEVVGRDDDKDEIMRFLIPENGEDSGTTVVAIVGIGGVGKTTLSQLLYNDHRVQNHFGTRVWAHVSEEFDVFTI
TKKVYESVTSRPCEFTDLDVLQVKLKERLIGPFLLVLDDLWNENFADWDLLRQPFTSAARGSRIIVTTRSQRVATIMCSV
HVHNLKPLSDGDCWSLFMRTVFPNQDPCLDQEIGDLAERIVYKCHGLPLAAKTLGGVLRFEGNVVEWERVLSSRIWDLPA
DKSNLLPVLRVSYYYLPAHLKRCFAYCSIFPKGHAFEKEKVVLLWMAEGFLQQTRSSKNLEELGDEYFSELESRSLFQKT
KTRYMMHDFINELSQFASGEFSSKFENGCKFQISEKTRYLSYLRDNYGEPMRFEALREVKYLRTFLPLSLTNSSRSCCLD
TMVSEKLLPTLTRLRVLSLSHYKISRLPPDFFRNLSHARFLDLSRTELEKLPKSLCYMYNLQTLLLAYCSSLKDLPTDIC
NLINLRYLDLIGTKLKRMPKRFGRLKSLQTLTTFFVSASDGARICELGELDELHGKLRIVELQRVVDVADAAGANLDSKK
HLKEIDFIWRTGSSSSESNTNPHRTQNEAEVFEKLRPHRRIEKLAIERYNGKKFPDWLCDSSFSRVVCIRLRECRNRSSL
PSFGQLPGLKELYISGMVGLRSIGSEFYLSPSLRDRDQQPFKSLETLRFDNLPDLEDWSDIRVTKGDLFPSLKKLSILRC
PELTGNLPSFLPSLISLHIHKCGVLDFQPDHHEYSYRNLQRLSIKSSCDSLVTFPLGHFASLHALEFDNCISLQSLQLSK
EHSYGPNALRNLRINDCQNLQRLPELNLQVTVSVTNCRNLRQPMEPQPQYHQFHLPRLNVSGSQRSHGSHRSYDSRSPSR
YD*

DNA
ATGATTGTAGGAGAGATGGTTCTCTCGGCTTTTTTACAAGCTCTCTTCCAGACACTGATGTCCGGTCCTTTCAAGTCCTT
CTTCAAGAGGCGAGAACTGAACGAGTGTGTACTAGAGAGGCTCAACATTGCTTTGTTGACAATAAGTGCGGTGCTGATTG
ATGCGGAGGAGAAACAGATTACAAACCCGTCGGTGGAAAAATGGGTCAACGAGCTGAGAGATGTTGTTTACCATGCTGAG
GATGCTCTTGATGATATTGCTACAGAAGCTCTGCGTCTCAACATAGGAGCTGAATCTTCTTCCAATAGGCTGAGACAGCT
TCGTGTCAGAACCCTGGCAGATTTTTTGGAAGGGAACAGTGATCATTTGGAGACCAGGCTCGAGAAGGTCACGATGAGGC
TCGAGCGTTTAGCCTCGCAAAGAAATATCTTGGGTTTGAAAGAGATAACTGCAATGACACCCAAACAAAGGTTGCCAACT
ACATCTCTTGTGGATGAATCTGAAGTGGTTGGTAGAGATGATGATAAAGATGAGATCATGAGATTCTTGATTCCTGAGAA
CGGGGAGGATAGTGGGACAACCGTTGTAGCTATTGTTGGAATTGGTGGGGTTGGCAAAACTACACTTTCACAACTCCTAT
ACAATGATCATCGTGTTCAGAATCATTTTGGAACTAGGGTCTGGGCTCATGTCTCAGAGGAGTTTGACGTTTTCACGATC
ACCAAGAAGGTTTATGAATCCGTTACTTCCCGGCCTTGCGAGTTCACGGATCTGGATGTACTTCAAGTCAAATTGAAGGA
GAGGTTAATAGGACCGTTTCTGCTTGTTCTAGATGATCTGTGGAATGAAAATTTTGCGGATTGGGATCTTCTACGCCAAC
CCTTCACATCTGCTGCTCGAGGGAGCCGGATTATTGTGACAACACGAAGCCAACGCGTTGCAACCATTATGTGTTCTGTC
CATGTACACAACCTTAAGCCATTATCTGATGGAGATTGTTGGTCGTTGTTTATGAGAACCGTTTTTCCTAATCAAGATCC
GTGCTTAGATCAAGAAATTGGAGATCTTGCGGAGAGGATAGTGTACAAGTGCCACGGCTTGCCCTTGGCTGCGAAAACAC
TTGGTGGTGTTTTACGGTTTGAAGGTAACGTCGTAGAATGGGAGAGAGTTCTAAGCAGCAGGATTTGGGATCTTCCAGCT
GATAAGAGCAATCTACTTCCAGTTTTACGGGTAAGCTACTATTACCTTCCAGCTCACTTGAAACGATGTTTTGCCTATTG
TTCGATATTTCCCAAAGGGCATGCGTTTGAGAAGGAAAAGGTAGTTCTTCTGTGGATGGCAGAAGGTTTCTTGCAGCAGA
CGAGAAGCAGTAAGAATCTAGAAGAGCTTGGGGATGAGTACTTTTCAGAACTGGAATCAAGGTCGCTTTTCCAAAAGACC
AAGACTAGATATATGATGCATGACTTCATCAATGAGCTTTCTCAGTTTGCTTCAGGAGAGTTCAGCTCCAAGTTTGAAAA
TGGCTGCAAATTTCAGATTTCAGAAAAGACTAGGTATCTATCCTACCTACGAGATAATTACGGTGAACCTATGAGGTTTG
AAGCTCTCCGTGAGGTGAAGTATCTCAGAACTTTTCTACCACTCAGCCTCACAAATTCTTCGCGGTCATGCTGCTTAGAT
ACAATGGTCAGCGAGAAGCTACTTCCAACGCTTACCCGCTTGCGTGTTTTGTCTTTGTCACATTACAAGATCTCAAGGCT
GCCTCCAGACTTTTTCAGGAACTTGAGCCATGCGCGGTTCTTGGATCTCTCTCGCACTGAACTCGAGAAGCTTCCGAAGT
CCCTTTGTTATATGTATAACCTCCAGACACTTCTTTTGGCCTACTGTTCCAGTCTGAAGGACCTACCTACAGACATCTGC
AACCTCATCAATCTGCGGTATCTTGATCTGATTGGGACGAAGCTAAAACGAATGCCGAAAAGATTTGGTAGATTGAAGAG
CCTCCAGACTCTTACAACATTTTTCGTGAGTGCTAGTGATGGGGCAAGGATTTGTGAACTTGGAGAACTCGATGAACTCC
ATGGCAAACTCAGAATAGTCGAGCTACAGCGAGTTGTGGATGTTGCTGATGCTGCAGGAGCAAATTTAGACAGCAAGAAA
CATCTAAAAGAGATTGATTTTATCTGGAGAACTGGATCTAGTAGCTCAGAGAGCAATACAAATCCTCACCGGACGCAGAA
CGAAGCTGAAGTCTTTGAGAAGTTACGCCCACATCGCCGTATCGAGAAGCTCGCCATTGAGAGATACAACGGAAAAAAGT
TTCCAGATTGGCTATGCGATTCCTCGTTCTCAAGAGTTGTGTGCATACGCCTCAGAGAATGTCGAAACCGTTCCTCCTTG
CCATCTTTTGGTCAACTACCAGGTCTCAAAGAGCTTTACATTTCAGGAATGGTCGGACTCAGAAGCATAGGTTCCGAGTT
CTACTTAAGTCCATCACTGCGCGATCGAGACCAACAGCCGTTTAAGTCACTCGAAACGCTGCGGTTTGATAACCTGCCTG
ATTTAGAAGACTGGTCAGACATAAGGGTCACCAAAGGAGACTTATTCCCTTCTCTAAAGAAACTTTCCATACTAAGATGT
CCGGAGCTAACCGGGAATCTACCGAGTTTTCTTCCTTCTCTGATATCTCTTCATATCCATAAATGTGGGGTCTTAGATTT
CCAGCCAGACCACCACGAGTACAGCTACAGGAATCTTCAAAGGCTAAGCATAAAAAGCAGCTGTGACTCTCTCGTTACAT
TTCCTTTAGGCCATTTCGCCAGCCTCCACGCGCTTGAGTTTGATAACTGCATATCTCTGCAGTCTTTGCAGCTCTCAAAG
GAGCATTCGTATGGTCCGAACGCTCTAAGAAATCTGAGAATCAATGACTGTCAGAATCTGCAGCGTCTTCCAGAGCTGAA
CTTACAGGTCACGGTCTCGGTCACAAACTGCAGGAATCTCAGACAGCCGATGGAACCACAGCCTCAATATCATCAGTTTC
ATCTTCCAAGACTAAATGTTTCAGGCTCACAGAGGTCTCATGGTTCACACAGGTCATATGATTCACGTTCACCTTCAAGA
TATGATTAA