Details for Chinese cabbage Locus Brara.E02669

Position : A05 ( 5`- 23362083 .. 23363279 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02669

Protein [Map View]
MILRRLVLSATSSSNLTRTQPLSVSATRLLSSSGYDTKLARLTHKDWLAPNEVLKIFETVKDPTFLIPAYRHYSKRKDYQ
PTEPLYALLINKLGHAKMFDEIERLVKSLTLEAKRCRFSEEFFYSLMKVYGNSAGRINKAIEILFSMPEFGCWPSVKSFN
FILNLLVKAKLFDEIHEIFVSAPKLGVEIDGCCLNILIKGLCESGNLEAALQVLDEFPKLKSRPNVMTFSPLIRGFCNKG
EFEGAFGLLERMEKEGIEPDAITFNILISGLRRKGRVEEGVEVMERMKVRGCQPNSGTYQAVLYGLLDKKRNLEAGEMMR
KMVSWGMRPSFLSYKKMVLGLCETKDVVDLDWVLRQMVSHGFVPKTGMWWKVVGCVVVKNKDSQRVLDRIIDRQGTSG*

DNA
ATGATTCTCCGGAGACTTGTTCTGTCTGCAACATCGAGCTCAAATCTCACAAGAACCCAACCGCTCTCTGTTTCCGCTAC
ACGCCTCCTCTCATCTTCGGGTTACGACACCAAACTCGCCAGGCTAACCCACAAGGACTGGTTAGCCCCCAACGAGGTTC
TAAAAATCTTCGAAACCGTCAAAGACCCAACCTTCCTCATCCCCGCCTACCGACACTACTCCAAACGCAAAGACTACCAA
CCCACAGAGCCTCTCTACGCCCTCCTCATCAACAAGCTCGGACACGCCAAGATGTTCGACGAAATCGAACGCCTCGTCAA
ATCCCTAACCCTCGAGGCAAAACGGTGCCGTTTCTCCGAAGAGTTCTTCTACAGCCTCATGAAGGTTTACGGGAACTCGG
CGGGGAGAATCAATAAAGCGATCGAGATCCTCTTCTCCATGCCCGAGTTCGGGTGCTGGCCGAGCGTTAAAAGCTTCAAT
TTTATACTGAACCTCCTCGTGAAGGCGAAGCTGTTCGACGAGATTCATGAGATCTTCGTGAGCGCTCCGAAGCTCGGCGT
TGAGATCGATGGTTGTTGTTTGAATATACTCATCAAGGGGCTGTGCGAGAGTGGGAATCTTGAAGCTGCACTCCAAGTGC
TCGACGAATTTCCTAAACTAAAATCACGTCCTAATGTGATGACGTTTTCTCCTTTAATCCGTGGGTTTTGTAATAAAGGC
GAGTTTGAGGGAGCGTTTGGGTTGTTGGAGAGGATGGAGAAGGAAGGGATCGAGCCGGATGCGATCACGTTTAATATTCT
GATCTCGGGGTTGAGGAGGAAAGGTAGGGTTGAAGAAGGGGTTGAGGTGATGGAGAGGATGAAGGTGAGAGGGTGTCAGC
CGAATAGTGGGACTTATCAGGCGGTGTTGTATGGTTTGTTGGATAAGAAGAGGAACTTGGAAGCTGGAGAGATGATGAGG
AAGATGGTTTCTTGGGGGATGAGGCCTAGTTTCTTGTCGTACAAGAAGATGGTTCTGGGGCTTTGTGAGACGAAGGATGT
TGTGGATTTGGATTGGGTTTTGAGGCAGATGGTGAGTCATGGTTTTGTTCCGAAAACGGGGATGTGGTGGAAAGTTGTGG
GTTGTGTGGTTGTGAAGAATAAGGACTCTCAAAGAGTTTTGGATCGCATTATTGATCGCCAGGGAACAAGTGGATAA