Details for Chinese cabbage Locus Brara.E02666

Position : A05 ( 5`- 23352601 .. 23354034 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02666

Protein [Map View]
MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIW
LRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRP
PTRKLKTTYKASKPNLFM*

DNA
ATGGTCGCTTTCCGGTTTCACCAGTACCAAGTGGTTGGGAGAGCACTTCCAACAGAGAAAGATGTGCAGCCTAAGATTTA
CCGTATGAAGCTTTGGGCCACTAATGAGGTCCGCGCTAAGTCCAAGTTTTGGTACTTCTTGAGGAAGCTGAAGAAGGTTA
AGAAAAGCAACGGACAAATGCTTGCCATCAATGAGATTTTCGAGAAGAACCCCACGAAGATTAAGAACTACGGTATCTGG
CTTCGTTACCAGAGCAGAACCGGGTACCACAACATGTACAAGGAGTTCCGTGACACCACTCTCAACGGTGCTGTGGAGCA
GATGTACACCGAGATGGCTTCTCGCCATAGAGTGAGGTTCCCTTGCATTCAGATCATCAAGACCGCAACAGTCCCTGCAA
AGCTGTGCAAGAGAGAGAGCACCAAGCAGTTCCACAACTCCAAGATCAAGTTCCCTCTTGTTTTCAGGAAGGTCAGGCCA
CCAACCAGGAAGCTCAAGACTACATACAAGGCTTCAAAGCCCAACCTTTTCATGTAA