Details for Chinese cabbage Locus Brara.E02659

Position : A05 ( 5`- 23313851 .. 23314486 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02659

Protein [Map View]
MSHIDMKKNSMRKNKKLVINIASTKKEFEANHRDLGSSIKDEKKRFESSERRRDVFDQRIRSKANEEIFDHGTSHDHSRV
RDGVMREVDVGTGLSGALKLLREQGTFKEKSSSKHHVGVRDINHGKDDRFKDAFKDITIDRVDECGRIMTEKEAFKKLCH
GFHGKKPGKRKQEKRMKKHEDSSKNILESSDRAVERMRQVHAELKSPYIFL*

DNA
ATGTCTCATATTGATATGAAGAAGAATTCGATGAGGAAGAACAAGAAACTGGTTATTAATATTGCTTCTACGAAGAAAGA
ATTTGAAGCTAATCATCGGGATCTTGGTTCTTCAATAAAAGATGAAAAAAAGAGGTTTGAATCATCAGAGAGACGAAGAG
ATGTGTTTGATCAAAGGATTCGTTCTAAAGCTAATGAAGAGATATTTGATCATGGTACTTCCCATGATCATTCTAGGGTT
AGAGACGGAGTGATGCGTGAGGTTGACGTCGGTACAGGATTATCTGGCGCGTTAAAGCTTCTCAGAGAGCAAGGAACTTT
CAAGGAGAAAAGCAGCAGCAAGCATCATGTAGGTGTTAGAGACATTAATCATGGTAAAGATGACAGATTCAAAGATGCGT
TTAAGGATATTACGATTGATAGGGTGGATGAATGTGGCAGGATAATGACTGAAAAAGAAGCGTTTAAGAAACTTTGTCAT
GGGTTCCATGGGAAGAAACCCGGGAAGAGGAAGCAAGAGAAACGGATGAAGAAACATGAAGACAGCTCAAAAAATATATT
GGAGTCTTCAGATAGAGCTGTGGAAAGGATGAGACAGGTTCATGCCGAGTTGAAGAGTCCGTACATTTTTCTCTAA