Details for Chinese cabbage Locus Brara.E02657

Position : A05 ( 5`- 23304674 .. 23306105 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02657

Protein [Map View]
MDAQYQNLPPLKRLRLMQRDLELAHQQQQQPSQPEVKPSQLPAKKRKHSRVDYDDDCENSSPAYRCLPAKKRIWAIDPDL
LSGTPFSPFDLNVEYTPYVNEDGIEKKNPSPLVESNPQEEDDDKENIDPLSIPEDEDGIMCGVCQSTDGDPSNPIVFCDG
CDLMVHASCYGNPLVKAIPEGDWFCSLCTESTSLKKKREKPFFSCCLCTTKGGAMKPTKDGRWAHITCSLFVPEVYFEDP
EGREGICCSEIPSRRWKERCYLCKVRRGCVIECSEMKCELAFHVSCGLKEELCIEYREGRRSGGIVVGFCSEHTKLWERQ
QESGKYKIVARG*

DNA
ATGGATGCTCAGTATCAGAACTTGCCTCCTCTCAAAAGGTTGCGATTGATGCAGCGAGATCTCGAACTTGCTCATCAACA
ACAGCAGCAACCGAGCCAACCTGAGGTGAAGCCGTCGCAGTTACCGGCGAAGAAGAGGAAACACTCTCGTGTTGATTACG
ACGACGACTGCGAGAACTCCTCCCCCGCTTACCGTTGTCTCCCGGCGAAGAAGAGGATCTGGGCGATCGATCCAGATCTG
CTCTCCGGTACTCCCTTTTCACCTTTCGATCTGAATGTTGAGTATACGCCTTATGTAAACGAGGACGGAATCGAGAAGAA
GAATCCATCTCCATTGGTTGAATCCAATCCACAAGAAGAGGATGATGATAAAGAGAATATCGATCCTCTATCGATACCTG
AAGACGAAGATGGTATCATGTGTGGTGTATGTCAAAGCACAGATGGTGATCCCTCGAATCCAATCGTCTTCTGCGACGGT
TGCGACTTAATGGTCCACGCTTCTTGCTATGGTAACCCTCTGGTTAAGGCCATACCGGAAGGTGATTGGTTTTGCAGTCT
ATGTACCGAGTCAACGTCATTGAAGAAGAAGAGAGAGAAGCCTTTTTTCTCTTGCTGCTTGTGTACGACCAAAGGTGGAG
CCATGAAGCCCACTAAGGATGGTCGTTGGGCCCACATCACTTGCTCGCTGTTCGTGCCGGAGGTTTACTTTGAGGATCCT
GAAGGAAGGGAAGGGATTTGTTGCAGCGAGATTCCGAGTAGGAGGTGGAAAGAGAGGTGTTACTTGTGCAAGGTTAGGCG
TGGGTGTGTTATCGAGTGTTCGGAGATGAAGTGTGAGTTGGCGTTTCATGTTAGTTGTGGGTTGAAGGAGGAGCTTTGTA
TTGAGTACCGTGAAGGTAGGAGGAGTGGTGGTATTGTTGTTGGTTTCTGCAGTGAGCATACTAAACTTTGGGAAAGGCAA
CAGGAAAGTGGAAAGTACAAGATTGTTGCCAGAGGTTAA