Details for Chinese cabbage Locus Brara.E02656

Position : A05 ( 5`- 23302513 .. 23304411 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02656

Protein [Map View]
MSGRNRGSYGGGLQPPINQPPFVRGLGGHAPPPLPHPHPSRPLDDNRELPQFRNHHPQHHHHSIIEDRIAAQNQDVQGLL
ADNQRLAATHVALKQELEVAQHELQRMMHYIDSLRAEEDIMMREMYDKSRRCEVELHQVEALRADVQKVRADIKEFTASR
QELTSQVHLMTQDLGRLTAELQQIPTLTAEIENTKQELQRARAAIDYEKKGYAENYEHGKVMEQKLVAMARELEKLRAEI
ATSESRAHATGPVGNPGGVGYGGGYGNHDPAGYAVNPYQPNYAMNPAQAQGGVEGYYPPPYGAAPTAWAGGYDPQQQQQQ
YYPQQGQGQ*

DNA
ATGTCCGGAAGAAATCGCGGATCGTACGGCGGCGGCTTACAACCTCCGATCAACCAACCGCCTTTCGTCAGAGGCTTAGG
AGGACACGCACCTCCTCCTCTTCCTCATCCTCATCCCTCTCGTCCCTTAGACGACAACAGGGAACTCCCCCAATTCAGAA
ACCACCATCCTCAACACCATCATCACTCAATCATCGAAGACCGAATCGCAGCTCAAAACCAAGACGTGCAGGGCCTTCTC
GCCGATAACCAGAGGCTCGCCGCGACGCACGTGGCGCTGAAGCAGGAGCTGGAAGTAGCGCAGCACGAGCTGCAGAGGAT
GATGCATTATATCGATTCGCTGCGAGCCGAGGAAGATATAATGATGAGGGAGATGTACGATAAGTCGAGGCGGTGCGAGG
TGGAGCTGCATCAGGTGGAGGCGTTGCGCGCTGATGTTCAGAAGGTTAGGGCGGATATCAAGGAGTTTACTGCGAGCAGG
CAGGAACTGACGAGTCAGGTTCATTTGATGACTCAAGATTTGGGGAGGCTCACGGCTGAGTTGCAGCAGATACCGACTTT
GACTGCGGAGATTGAGAACACTAAGCAAGAGCTGCAACGCGCGAGAGCGGCGATTGATTATGAGAAGAAAGGGTATGCGG
AGAATTACGAGCACGGGAAAGTTATGGAGCAGAAGCTAGTTGCGATGGCTCGGGAGCTGGAGAAGCTTAGAGCTGAGATT
GCTACCTCGGAGAGTAGAGCTCATGCTACTGGTCCTGTTGGGAATCCTGGTGGAGTTGGTTATGGTGGTGGGTATGGAAA
CCATGATCCTGCTGGGTATGCTGTGAATCCTTATCAACCTAACTATGCCATGAATCCAGCACAAGCACAGGGAGGCGTTG
AAGGCTATTATCCTCCTCCATATGGAGCAGCACCCACTGCCTGGGCTGGTGGCTATGATCCTCAGCAGCAGCAACAACAG
TATTATCCACAACAAGGACAAGGACAGTGA