Details for Chinese cabbage Locus Brara.E02646

Position : A05 ( 5`- 23195478 .. 23197640 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02646

Protein [Map View]
MSQETAIESFKKFQHTWIGQLQHHLNHLRSVQNHHRNSATGDEERLREAVQRVMEICREYHRAKLATTEKDVVGVMAAPW
SSALERSLHWVGDWRPTTLFHLVYTESSILFESRIVDILRGFRTGDLSDLSPSQFRFKFVKGRKVSELQCETVKEENAIT
EELSEWQDDASELVMGTVSNLDQRIRRLAEIVHRADDLRLRTITGVVELLSPLQQAEFLIAAAELRRGVSGWGSSHDRRR
SANV*

DNA
ATGAGCCAAGAGACAGCGATAGAGAGCTTCAAGAAATTTCAACACACATGGATAGGGCAGCTACAACACCACCTCAACCA
CCTGCGCTCCGTCCAAAACCACCACCGCAACTCTGCTACCGGTGACGAGGAACGGCTGAGGGAAGCGGTGCAGAGAGTGA
TGGAAATTTGTAGAGAGTACCACAGGGCGAAGTTGGCCACGACGGAGAAAGATGTGGTCGGAGTTATGGCTGCTCCTTGG
TCTTCGGCTCTTGAACGGTCACTCCATTGGGTTGGTGATTGGCGACCAACTACCTTGTTTCATCTGGTTTACACCGAGTC
TAGTATTTTGTTTGAGTCTCGTATCGTTGATATTCTCCGGGGGTTTCGTACCGGTGATCTCAGTGATCTATCTCCTTCTC
AATTCAGGTTTAAATTTGTCAAAGGCAGGAAGGTGAGTGAGCTACAATGCGAGACGGTAAAGGAAGAGAATGCGATAACG
GAAGAGTTATCAGAGTGGCAAGACGACGCGAGCGAGCTCGTCATGGGAACTGTGTCGAATCTCGACCAGAGGATACGACG
GCTAGCAGAGATCGTTCATCGAGCCGATGATCTCCGACTGAGAACGATCACAGGTGTGGTGGAGCTCCTAAGTCCGCTGC
AACAAGCCGAGTTTCTCATTGCTGCGGCTGAGCTTCGTAGGGGGGTTTCTGGTTGGGGGAGTAGCCACGACCGTCGTCGA
AGTGCCAACGTCTAA