Details for Chinese cabbage Locus Brara.E02642

Position : A05 ( 5`- 23182618 .. 23184718 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02642

Protein [Map View]
MSLSSPTSACSSSRCYSSGLSLPIGFRSSPINVGLVSHPRRHTNSPRKLVIASSSSSDPLLVKAAKGQPVTRPPAWMMRQ
AGRYMSVYKKLALKHPSFRERSENTDLIVEISLQPWQAFKPDGVIIFSDILTPLPAFGVPFDIEEVKGPVIQSPIRTEDD
LKKLHPIDLEKLQFVGDSLKILRREVGEHAAVLGFVGAPWTIATYIVEGGTTRTYTVIKRMCHTAPNVLRALLSHLTKAI
TEYVVYQVEHGAHCIQIFDSWGGQLTPEMWERWSKPYIEEIIDAVKRRCPDTPIVFYINGNGGLLERMKGTGADVIGLDW
TVDMADGRRRLGSDVSVQGNVDPAFLFSPLPALTEEIQRVVKSAGPKGHILNLGHGVLVGTPEEAVAHFFETARSLDYKT
FFQNHVPAESELVA*

DNA
ATGAGTTTATCATCACCAACCAGTGCTTGCAGCTCGTCGAGATGTTACTCCTCGGGCTTATCGTTGCCAATAGGGTTCCG
ATCAAGTCCCATCAATGTAGGATTGGTTTCTCACCCAAGAAGACACACTAACTCTCCTCGGAAGCTCGTCATAGCTTCCT
CCTCATCCTCAGATCCTTTATTGGTTAAAGCTGCTAAGGGGCAACCAGTGACTCGTCCTCCAGCTTGGATGATGAGGCAA
GCAGGAAGGTACATGTCCGTCTACAAAAAGCTAGCCCTGAAGCACCCTTCCTTCAGAGAGAGATCAGAGAACACTGATCT
CATTGTGGAGATCTCTCTGCAGCCTTGGCAAGCTTTTAAACCAGACGGTGTCATCATATTCTCCGACATCCTCACTCCCT
TACCCGCCTTCGGCGTCCCTTTCGACATCGAGGAAGTCAAAGGCCCTGTGATCCAGTCCCCCATCAGAACCGAAGATGAT
CTCAAGAAGCTGCATCCTATTGATCTTGAGAAGCTTCAGTTCGTTGGAGACTCTCTGAAGATTCTGAGACGAGAGGTGGG
GGAGCATGCTGCTGTGTTGGGTTTCGTTGGAGCGCCGTGGACGATAGCGACTTATATAGTTGAAGGAGGGACGACTCGGA
CGTATACTGTGATCAAGAGGATGTGTCATACTGCACCTAATGTGCTGAGAGCTCTTTTGTCTCATTTGACTAAGGCTATT
ACGGAGTATGTTGTGTACCAAGTTGAGCACGGAGCTCACTGCATACAGATATTTGATTCTTGGGGTGGGCAGTTGACTCC
TGAGATGTGGGAGCGCTGGTCCAAACCTTACATTGAAGAGATCATTGATGCTGTGAAGAGAAGATGTCCAGACACGCCGA
TAGTTTTCTACATCAATGGAAACGGCGGCCTTCTTGAGCGGATGAAAGGAACCGGAGCTGATGTTATTGGACTAGACTGG
ACTGTAGATATGGCTGATGGAAGGAGGAGACTTGGGAGCGATGTTAGCGTGCAGGGGAATGTTGATCCAGCTTTCCTATT
CTCTCCGCTTCCTGCTTTAACTGAAGAAATTCAAAGAGTTGTGAAGAGTGCTGGACCAAAAGGGCATATACTCAACCTAG
GACATGGTGTCTTGGTAGGGACACCAGAGGAAGCCGTGGCTCATTTCTTTGAAACCGCAAGGAGCTTGGATTACAAAACG
TTTTTCCAAAACCATGTTCCTGCAGAATCTGAACTGGTTGCCTGA