Details for Chinese cabbage Locus Brara.E02641

Position : A05 ( 5`- 23174095 .. 23179421 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02641

Protein [Map View]
MAGRNIEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQELYELSAEYEGKRDPKKLEELG
SVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAYRRRIKKLKKGDFADESSATTESDIEETFKRLVGVLGKSPEEIFDA
LKNQIVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQREIQAAFRTDEIRRTPPTPQDEMRAG
MSYFHETIWNGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARMMAANFYYNQIE
NLMFELSMWRCTDEFRAKADEIHRNSRKDAAKHYIEFWKTIPPTEPYRVILGDVRDKLYHTRERSRQLLSNGISDIPEEA
TFTNVEQFLEPLELCYRSLCSCGDRPIADGTLLDFLRQVSTFGLSLVRLDIRQESERHTDVLDAITKHLDGSSYRDWSEE
RRQEWLLSELSGKRPLFGPDLPKTEEIADVLDTFKVISELPSDCFGAYIISMATSPSDVLAVELLQRECHVKTPLRVVPL
FEKLADLEAAPAAVSRLFSLDWYKNRINGKQEVMIGYSDSGKDAGRLSAAWELYKAQEELVKVAKKYGVKLTMFHGRGGT
VGRGGGPTHLAILSQPPDTVNGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMNPPVSPKPEWRALLDAMAVVA
TEEYRSVVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRFHLPVWLGFGAAFRYAIKK
DVRNLHMLQDMYKHWPFFRVTIDLIEMVFAKGDPGIAALYDKLLVSEDLWAFGEKLRTNFEETKSLVLQTAGHRDLLEED
PYLKQRLRLRDSYITTLNVCQAYTLKRIRDPNYNVTLRPHISKEIMQSSKSAQELVKLNPTSEYAPGLEDTLILTMKGIA
AGLQNTG*

DNA
ATGGCGGGTCGTAACATAGAGAAGATGGCGTCCATTGATGCTCAGCTTCGTCAACTGGTTCCTGCTAAAGTGAGTGAAGA
CGACAAGCTCATCGAGTACGACGCTCTTCTCCTCGATCGTTTCCTCGACATTCTCCAGGACTTGCATGGAGAGGATCTCC
GTGAAACGGTACAAGAGTTGTACGAGCTCTCTGCTGAGTATGAAGGCAAACGTGACCCTAAGAAGCTTGAGGAGCTAGGG
AGTGTGCTCACGAGTTTGGATCCTGGCGACTCCATTGTTATCTCCAAGGCCTTCTCTCACATGCTTAACTTAGCCAACTT
GGCTGAGGAGGTGCAGATTGCTTACCGGAGAAGGATCAAGAAGCTGAAGAAGGGGGATTTCGCTGATGAGAGCTCTGCCA
CTACCGAGTCTGATATCGAGGAGACTTTCAAGAGGCTTGTTGGTGTTCTTGGTAAGTCTCCTGAAGAGATCTTTGATGCT
TTGAAGAACCAGATTGTTGATTTGGTTTTGACTGCTCATCCTACTCAGTCGGTGCGTAGATCTTTACTTCAGAAGCACGG
CAGGATAAGAGATTGTCTAGCTCAGTTGTATGCAAAGGACATTACTCCTGATGACAAGCAGGAGCTTGATGAGTCTCTCC
AAAGAGAGATTCAAGCTGCATTCCGCACAGATGAGATTAGGAGAACACCTCCAACCCCACAAGATGAAATGAGAGCTGGA
ATGAGCTATTTCCATGAGACAATCTGGAACGGTGTCCCTAAGTTCCTTCGCCGTGTTGACACGGCTCTGAAGAACATTGG
AATTGATGAACGTGTTCCTTACAATGCCCCACTGATTCAGTTCTCTTCATGGATGGGCGGTGATCGTGATGGTAATCCGA
GGGTCACACCTGAGGTCACTAGAGACGTGTGCTTGTTGGCTAGAATGATGGCAGCCAATTTCTACTATAACCAGATTGAG
AATCTCATGTTTGAGTTGTCTATGTGGCGTTGCACTGATGAGTTTCGTGCCAAGGCTGATGAAATCCACAGGAACTCAAG
GAAAGATGCTGCAAAACATTACATAGAATTTTGGAAGACAATTCCTCCAACTGAGCCATACCGTGTGATCCTTGGTGATG
TGAGGGACAAACTCTATCACACACGTGAGCGCTCTCGTCAATTGCTGAGTAACGGAATCTCAGACATCCCTGAAGAAGCT
ACTTTCACCAATGTGGAACAGTTCTTGGAGCCTCTTGAGCTATGTTACCGCTCACTATGTTCATGTGGTGACCGCCCAAT
AGCTGATGGAACCCTTCTTGATTTCTTGAGGCAAGTCTCCACCTTCGGACTCTCCCTTGTCAGGCTTGACATTAGGCAAG
AGTCTGAACGCCACACCGATGTCTTGGACGCTATCACCAAACACTTGGACGGTTCCTCGTATAGAGACTGGTCTGAAGAA
CGTCGCCAAGAATGGCTTCTATCTGAACTAAGCGGCAAACGTCCACTTTTCGGACCAGATCTTCCCAAAACCGAAGAAAT
CGCTGATGTTCTTGACACATTCAAAGTCATATCCGAACTGCCTTCGGATTGCTTTGGAGCTTACATTATCTCTATGGCGA
CCTCACCTAGTGATGTCCTTGCTGTTGAGCTTCTACAGCGTGAGTGCCATGTGAAAACGCCGCTTAGAGTTGTTCCTCTC
TTTGAGAAGCTAGCTGACCTCGAAGCAGCTCCTGCAGCTGTTTCAAGACTCTTTTCCCTAGACTGGTACAAGAACCGTAT
CAACGGTAAACAAGAGGTTATGATTGGTTACTCTGACTCGGGGAAAGACGCTGGGCGTCTCTCAGCTGCTTGGGAGCTGT
ACAAAGCTCAAGAAGAGCTTGTGAAGGTTGCTAAGAAGTACGGAGTGAAGCTGACTATGTTCCATGGCCGTGGTGGCACT
GTCGGAAGAGGAGGTGGTCCCACACATCTTGCTATATTGTCTCAGCCACCGGATACAGTTAATGGCTCGCTGAGAGTGAC
GGTTCAAGGTGAAGTCATTGAGCAATCGTTTGGAGAGGAACACTTGTGTTTTAGAACACTTCAGCGTTTCACAGCTGCTA
CTCTTGAGCATGGTATGAACCCTCCCGTTTCGCCAAAACCAGAGTGGCGCGCTTTGCTCGATGCAATGGCGGTTGTTGCA
ACCGAGGAGTATCGATCTGTTGTGTTCCAAGAGCCTCGATTTGTCGAATACTTCCGCCTTGCTACACCTGAGCTGGAGTA
TGGACGTATGAACATCGGAAGCAGACCTTCAAAGCGAAAACCGAGCGGTGGGATCGAGTCTCTCAGAGCAATCCCATGGA
TCTTTGCTTGGACACAAACAAGGTTCCATCTTCCTGTATGGTTAGGATTTGGAGCAGCTTTCAGGTATGCAATCAAGAAG
GATGTGCGGAACCTCCACATGCTGCAAGATATGTACAAACACTGGCCTTTCTTCCGAGTCACCATCGATCTTATTGAGAT
GGTGTTCGCCAAGGGAGACCCCGGGATCGCTGCATTGTACGACAAACTTCTTGTCTCGGAAGATCTATGGGCCTTTGGGG
AGAAACTCAGAACCAACTTTGAAGAAACCAAGAGCCTCGTCCTCCAGACTGCTGGACACAGAGACCTTCTCGAAGAAGAC
CCTTACTTGAAACAGAGACTTAGGCTGCGTGACTCTTACATTACGACCCTCAACGTGTGCCAAGCCTACACATTGAAGAG
AATCCGTGATCCAAACTACAATGTGACTCTGCGACCACACATTTCGAAAGAGATCATGCAATCAAGCAAATCGGCACAAG
AGCTTGTGAAGCTTAACCCAACGAGTGAGTACGCGCCTGGACTTGAGGACACGCTCATCTTAACCATGAAAGGTATTGCC
GCAGGACTGCAAAACACCGGTTAA