Details for Chinese cabbage Locus Brara.E02640

Position : A05 ( 5`- 23170324 .. 23173208 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02640

Protein [Map View]
MLKPIKHVSEPDTVADKLRRSLNMSNSKPDNVHVEFGSPITPLQTQPSGLTSAATTTSNSSFSSSSSGSVSGRAVHTPVS
TKTDSGRSNPSAVQSSRATAPSASQTSKTSNPSAAKSSKSTTSGSSNPAGAKAGSNPRPGRVSSASDSASGSTKRSTKSS
TPPPQPVKILPGGNLFPSGKVHITGMTQGVPKRMILGPGSKSYGYGSVMRGTNSYSSTPAKLTTSSGSSSSGALVISRCS
SGGGGSEVDTSWKRVMNSPNPEEVKRLGNEMFKKGCFSEALKFYDRALELSPSNATYRSNRAAALSGLGRIAEAVIECEH
AIKLDPNFARAHHRLATLLLRLGQVDNAGKHFFSVEEPSDPMVVKVLEEVDRHLNKCAEARRRGEWNIVLTEVSAAMESG
ADMSPQLAMCKVEALMKLLRLDEAQTILASAPKIEILLPSSFTRIRFFDMISEAYTYFVKSQMELALGRFENAVTFVEKA
SEMEPRNSEIETLNRNVKMIVRTRDRGNGLYNSERYTEASAAYAEGLKFDPYNATLFSHRADCFFKVGMWESSIEDCSHA
LLILPSCTKARRQRAASYSKLERWAEAVSDYETLRKELSYDREIAESLFHAQVALKKSRGEVVLNMEFGGEVEEVFSLEE
LKAALTRPGVSVVLFMKAFDQQCKEISIFMNALCIRYPSLHFLKVEIEKCPGVGDAEKVRVVPTFKIYKVGIRMKEIVCP
SKEALEISVRHYGL*

DNA
ATGTTGAAGCCTATTAAACATGTGTCGGAACCTGACACTGTCGCCGATAAGCTTCGCAGATCACTGAATATGTCAAATAG
TAAACCAGACAATGTTCATGTCGAATTCGGATCGCCAATTACTCCACTTCAGACACAACCGAGTGGACTCACCTCCGCGG
CAACCACCACTTCCAACAGTAGCTTCAGTTCTAGCTCATCCGGATCGGTATCGGGCCGTGCCGTACACACTCCGGTTTCA
ACAAAAACCGACTCCGGTCGGTCAAATCCCTCCGCCGTACAATCTTCTAGGGCCACCGCTCCCTCCGCCTCTCAAACTTC
TAAGACAAGCAATCCCTCCGCCGCTAAATCTTCCAAGTCCACCACTTCCGGGTCTAGCAACCCCGCCGGCGCTAAAGCGG
GATCGAACCCGAGACCGGGACGTGTCTCTTCAGCGTCGGACTCAGCTTCTGGCTCAACAAAACGATCAACAAAAAGCTCG
ACTCCGCCGCCGCAGCCGGTGAAAATCCTCCCCGGCGGGAATCTTTTCCCGTCCGGGAAGGTTCATATAACAGGGATGAC
ACAAGGAGTGCCAAAACGCATGATTCTCGGACCAGGCTCCAAGTCCTACGGATACGGTAGCGTAATGCGAGGAACAAACA
GCTATTCGTCAACGCCTGCAAAGCTAACAACGAGTTCTGGTTCTTCTTCCTCCGGTGCACTCGTAATATCCCGCTGCTCT
AGCGGTGGTGGTGGCTCTGAGGTGGATACGTCGTGGAAGAGAGTGATGAACAGTCCCAATCCAGAGGAGGTAAAGAGACT
TGGAAACGAAATGTTCAAGAAAGGTTGTTTCAGTGAGGCTTTGAAGTTTTACGACCGAGCGTTAGAGCTCTCGCCGAGTA
ATGCCACTTACCGTAGCAACCGAGCAGCTGCTTTGTCTGGTTTAGGTCGGATTGCTGAAGCTGTGATTGAGTGTGAACAT
GCTATTAAACTGGATCCGAATTTTGCAAGGGCTCATCATCGTTTAGCCACATTGCTTCTTAGATTAGGTCAAGTTGATAA
TGCGGGGAAGCACTTCTTTTCTGTGGAGGAGCCATCAGATCCCATGGTGGTGAAGGTGCTTGAAGAAGTTGATAGACACT
TGAACAAATGCGCAGAAGCAAGAAGACGTGGTGAATGGAATATTGTTTTGACAGAAGTAAGTGCAGCTATGGAGTCTGGA
GCTGATATGTCTCCTCAGCTAGCTATGTGTAAAGTTGAAGCACTAATGAAGCTCCTAAGGCTTGATGAGGCTCAGACAAT
ACTAGCATCTGCCCCCAAAATAGAAATATTATTACCATCATCTTTCACACGGATTCGGTTTTTCGATATGATCTCTGAAG
CTTACACATATTTTGTAAAATCTCAGATGGAATTGGCTCTAGGAAGGTTTGAAAATGCGGTTACATTTGTAGAGAAAGCT
TCAGAAATGGAACCACGAAACAGTGAAATTGAAACATTGAATAGAAACGTTAAAATGATTGTTAGGACGCGAGATCGTGG
TAACGGTCTTTATAACTCAGAAAGGTACACTGAAGCGAGCGCAGCTTATGCAGAAGGCCTTAAGTTTGATCCATACAATG
CTACTTTGTTCAGTCATAGAGCTGACTGTTTCTTTAAAGTTGGGATGTGGGAGAGCTCAATAGAAGATTGTAGCCATGCA
TTGCTCATTCTACCGAGTTGCACAAAGGCTCGTCGTCAAAGAGCTGCCTCATACAGCAAGCTGGAGAGATGGGCTGAAGC
AGTTAGCGATTATGAAACGTTGAGAAAGGAACTATCTTATGATAGAGAAATAGCTGAATCTTTGTTTCACGCTCAAGTTG
CATTGAAGAAATCTCGTGGAGAAGTAGTTTTAAACATGGAGTTTGGAGGTGAAGTTGAGGAGGTTTTTAGCCTTGAAGAG
TTAAAAGCTGCATTGACCCGTCCAGGAGTTTCTGTTGTACTTTTTATGAAAGCCTTTGATCAACAATGCAAAGAGATATC
TATTTTTATGAATGCACTATGTATTCGTTACCCATCTCTGCACTTCCTCAAGGTGGAGATAGAGAAATGTCCTGGAGTGG
GTGATGCAGAGAAAGTGAGAGTTGTGCCAACCTTCAAGATTTACAAAGTTGGTATTAGGATGAAGGAGATTGTGTGCCCA
AGCAAGGAAGCACTGGAGATTTCAGTGAGACACTATGGCCTTTAG