Details for Chinese cabbage Locus Brara.E02639

Position : A05 ( 5`- 23163056 .. 23165446 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02639

Protein [Map View]
MPSSPRLKLFHARTSPSTRRSTSLIVLTSLAIGLFGFIFGLSAIVFPSRTCLTNSPPKTVKVVWDVAGNSNGNGLSGGVK
RHKVMGFVGIQTGFGSAGRRRALRSTWMPSDPEGLRRLEESTGLAIRFIIGKTKDEKKMAELRREIAEYDDFILLDIEEE
YSKLPYKTLAFFKAAYALYDSEFYVKADDDIYLRPDRLSLLLAKERSHSQTYLGCLKKGPVFTDPKLKWYEPLADLLGKE
YFLHAYGPIYALSADVVTSLVALKNNSFRMFSNEDVTIGAWMLAMNVNHENHKTLCERECSPYSIAVWDIPKCSGLCNPE
KRMLELHKIESCSKSPTLPSEDE*

DNA
ATGCCGTCTTCACCGAGGCTGAAGCTCTTCCACGCGCGTACATCACCCTCCACGCGCCGATCGACGTCTCTGATCGTCCT
CACCTCTCTCGCGATCGGGCTATTCGGATTCATCTTCGGACTCTCCGCCATTGTTTTCCCTAGCCGGACCTGCCTCACGA
ACTCCCCTCCGAAGACGGTAAAGGTCGTCTGGGACGTCGCCGGCAATTCAAACGGCAATGGCCTCAGCGGCGGAGTCAAG
AGGCATAAGGTGATGGGATTCGTCGGTATCCAAACCGGATTCGGATCAGCTGGGAGGAGACGAGCTCTCAGGAGCACGTG
GATGCCGTCCGATCCAGAAGGGCTTCGACGCTTGGAGGAGTCAACAGGGTTGGCTATTAGGTTTATCATAGGCAAGACCA
AAGATGAAAAGAAAATGGCTGAGCTTAGAAGGGAGATTGCAGAGTATGATGACTTTATACTGCTTGATATCGAGGAGGAG
TACAGTAAGCTCCCATACAAAACTTTGGCTTTCTTCAAAGCTGCGTATGCTCTGTATGATTCGGAGTTCTATGTCAAAGC
TGATGATGATATCTATTTGAGGCCAGATCGTTTGTCATTGCTGTTGGCTAAAGAGAGGAGTCACTCGCAGACATACCTTG
GATGCTTGAAAAAAGGTCCTGTTTTCACAGATCCAAAACTTAAATGGTATGAGCCTTTGGCAGATTTGCTGGGGAAGGAG
TACTTTCTTCATGCTTATGGCCCCATTTACGCTCTTTCTGCTGATGTTGTCACCAGTTTGGTTGCCCTCAAGAATAACAG
TTTTAGGATGTTTAGCAACGAGGACGTGACAATAGGTGCGTGGATGCTGGCAATGAACGTCAACCACGAGAACCACAAGA
CCCTTTGTGAACGAGAATGCTCACCCTACTCCATTGCTGTTTGGGATATACCAAAATGCTCAGGGCTTTGTAACCCAGAG
AAAAGGATGTTGGAACTTCACAAGATAGAGAGCTGCTCAAAGAGCCCGACTTTGCCATCGGAAGATGAGTGA