Details for Chinese cabbage Locus Brara.E02636

Position : A05 ( 5`- 23133203 .. 23135224 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02636

Protein [Map View]
MATHSISRSILCRPAKSLSFLFTRSFASSSAPLAKSPATSLYTSSLLTRSRPLVAALSSAFRGGLVSVKGLSSQATSSSL
NDPSPNWSNRPPKETILLDGCDFEHWLVVVDPPEGDPTRDEIIDSYIKTLAQIVGSEEEARMKIYSVSTRCYFAFGALVS
EDLSHKLKELPKVRWVLPDSYLDVRNKDYGGEPFIDGKAVPYDPKYHEEWIRNNARANERNRRNDRPKNFDRSRNFERRR
ENMAGGPPPQRHPMGGPPPPHMGGSAPPPPPMGQNYGQRPPPNYGGPPPPHNNMGGQRPPANYGGAPPPPPPPNYGGPPP
PNYGGTPPQNNMGGAPPPNYGGAPPPNYGGPPPQNNMGGGGPPNAGWSGNNNNYQQQQGGGMQQPQYQNNYPPNRDGSGN
PYQG*

DNA
ATGGCGACGCATTCCATTTCTCGCTCCATTCTCTGCCGTCCGGCGAAATCTCTCTCCTTTCTCTTCACCCGATCCTTCGC
CTCCTCATCTGCTCCCCTCGCCAAATCCCCGGCGACTTCTCTTTACACGTCGTCTCTCCTCACCCGATCCCGTCCCTTAG
TCGCCGCCTTATCCTCCGCCTTCCGCGGTGGACTTGTGTCCGTCAAAGGTCTTTCGTCCCAGGCTACGTCGTCTTCTCTG
AACGATCCGAGTCCCAACTGGTCCAATAGGCCGCCCAAGGAGACGATTTTGCTCGATGGATGCGATTTCGAGCATTGGCT
TGTGGTTGTGGATCCGCCTGAGGGAGATCCCACTAGAGATGAGATCATCGACAGCTATATCAAAACCCTAGCTCAGATCG
TTGGCAGTGAAGAAGAAGCGAGGATGAAGATCTACTCTGTTTCGACTCGGTGCTACTTTGCTTTCGGAGCCCTTGTGTCT
GAAGATCTCTCTCACAAGCTGAAAGAGTTGCCAAAGGTGCGCTGGGTTCTTCCTGATTCTTACCTGGATGTGAGAAACAA
AGACTATGGAGGGGAACCTTTCATTGATGGGAAAGCTGTTCCTTATGACCCCAAGTACCACGAGGAATGGATAAGGAACA
ACGCTAGAGCCAATGAAAGAAACAGGCGCAATGACCGTCCTAAAAACTTTGATAGAAGCAGAAACTTTGAGAGGAGAAGA
GAAAACATGGCTGGAGGCCCTCCTCCCCAACGTCATCCCATGGGTGGCCCTCCTCCACCTCACATGGGTGGCTCTGCACC
CCCTCCACCTCCCATGGGGCAGAATTATGGACAAAGGCCTCCACCAAACTATGGAGGACCACCACCGCCACATAACAATA
TGGGAGGACAGAGGCCTCCAGCAAACTACGGAGGGGCACCACCACCACCACCACCACCGAACTATGGAGGACCACCACCA
CCAAACTACGGAGGAACGCCACCACAAAACAACATGGGAGGAGCACCACCACCAAACTACGGAGGAGCGCCTCCACCGAA
CTATGGAGGACCACCACCGCAGAACAACATGGGAGGAGGAGGTCCACCAAATGCAGGATGGTCAGGTAACAACAATAACT
ACCAGCAGCAGCAGGGTGGTGGAATGCAGCAGCCACAGTACCAAAACAACTATCCACCTAACCGGGATGGCAGTGGGAAC
CCGTACCAGGGTTAA